KEGG   Maylandia zebra (zebra mbuna): 101483349Help
Entry
101483349         CDS       T02814                                 

Definition
protein-glutamine gamma-glutamyltransferase E-like
Orthology
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101483349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 710 aa AA seqDB search
MSSETRRSIFKGVGLNYEINNTEHHTKKLSKDQLIVRRGQPFTVKVELTQPFNPDLYPLT
ITAETGKHPSENLGTKSRFGIPDKISRSPSAKAVWKVELEKRSYPLTGSLNLTITPPADA
PIGKYNLTARYRNEETLLATLVVLFNPWCPDDSVSLSDEAQRQEYVLNEHGIIYSGSENY
IRSVPWDFGQFEEDMVKICLKILDVNPKHLANAANDVSARCNPIYVSRVVSAMINSNDDY
GVVEGRWSGPYSGGNEPTHWSGSYPILKHWYDINCQSVKYGQCWVFAGVMCSVMRLLGIP
CRVITNFQSAHDSNKNLTIDVYHADYGVREKKTKDSVWNFHVWLECWMTRTDLAKDGKYD
GWQVVDPTPQEKSDGVYCCGPAPVKAILDGETDLKYDVPFVFAEVNADCIDWLCKADGTM
TKMLSDTKSVGQNISTKTVGSNTRLDITDKYKYKEGTEKERTVFKYALSRNKETMGNEGA
TNSTNGTSPGGIVPQPKINIQFKEVSKPKDGQDVSLKLVLNSESSTARPVSINISVQAMR
YNGSPVENIQSEVKEETLLPGKDLSIPILVPFLVYHEHMVDSDSMKISAMVTDKLEPKNV
YLAVNDVILLDPPISITTPSLASVNQSTTAEVVFMNPVNKTLTDCTLTISGSGLVDGEQN
CILPDLKPSHRFRVTFFLLPKKTGKKTLLADFDCSSFRDLKCTCTVNVQP
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcggagaccagacggtcaatttttaaaggagtcggtctcaactatgagatcaac
aacactgaacaccacaccaaaaaactctcaaaggatcagctgattgtgaggagaggtcag
ccgttcactgtgaaagttgaactgacgcaacctttcaaccctgacctttacccgctcacc
atcactgcagaaacaggaaaacatccatccgagaacctggggacaaagtcacgctttggt
attccagacaaaatcagccgttcgccgtcagcgaaggcggtatggaaggtggagcttgag
aagagatcttacccactaacgggttccttgaatttgaccattacccctccagctgacgct
ccaatcggaaagtacaacttaactgccagatataggaacgaggaaaccttgttggcaact
ctggtagtgctcttcaatccctggtgccctgatgattcagtgtctctctctgatgaggca
cagagacaggagtatgtgttgaatgaacatggtataatctatagtggaagtgagaactac
atcagatctgttccctgggactttgggcagtttgaagaagacatggtgaagatttgtctg
aagatcttggatgtcaaccccaaacacctggcaaatgcagccaatgatgtttctgctcgc
tgtaaccccatctacgtcagtcgtgtggtcagcgccatgatcaacagtaatgatgactat
ggcgtcgtggagggacggtggtcaggtccatactcgggtgggaatgaacccactcactgg
tctggcagctatcccatcctcaagcactggtatgacatcaactgccaatcagtcaaatat
ggacagtgctgggtatttgctggcgtgatgtgttcagtaatgcgtctgttgggcatccca
tgccgtgtgatcaccaacttccagtcagctcatgacagtaacaagaatctcaccattgat
gtgtaccatgctgactatggagtgagagagaaaaagaccaaggacagtgtctggaacttc
cacgtctggttagagtgctggatgacccgaactgacctggcaaaggatggaaaatatgac
gggtggcaagttgtggatccaacaccacaggaaaagagtgacggtgtatactgctgcggt
ccagccccagtcaaagccatcttggatggagaaactgatctcaaatatgatgtcccattt
gtctttgctgaggtcaatgcggactgcattgactggctgtgtaaagctgatggcacaatg
acgaaaatgctctctgacaccaagtcagtcggacagaatatctccaccaagactgttggc
tccaacacgaggctggacatcacagacaagtacaagtacaaggaaggcactgagaaggag
agaaccgtatttaaatatgccctctccagaaataaggagacaatgggcaatgaaggggcc
acaaacagtaccaatggaacatctcctgggggcatcgttccacagccaaaaataaacatc
caatttaaagaggtatccaagccaaaggacggtcaggacgtgagtctgaagctggtgctg
aacagtgagagcagcactgccaggcctgtgtccatcaatatcagcgtccaggccatgaga
tacaatggctcaccggttgaaaacatccagagtgaggtaaaggaagagacactgctgcct
gggaaagatctgtccatccctatcttggtccccttcttggtgtaccatgagcacatggtg
gactctgacagcatgaagatttcagctatggtcacagataagctggagccgaaaaatgtc
tacctagcagtgaatgatgtcattctgttggatcctccaatctccatcacaactcccagt
ctggcaagcgtgaaccaaagcacaactgctgaagtggttttcatgaacccagtcaacaag
acactgacagattgcactctgactatttctggaagtggtctcgtggacggagagcaaaat
tgcatacttccagacctgaaaccaagccacaggtttcgtgttacgtttttcttacttccc
aagaagactggcaagaagaccctcctggctgactttgactgctcctccttcagagacctc
aagtgcacctgtactgtcaatgtccaaccataa

DBGET integrated database retrieval system