KEGG   Maylandia zebra (zebra mbuna): 101483525Help
Entry
101483525         CDS       T02814                                 

Gene name
elp3
Definition
(RefSeq) elongator acetyltransferase complex subunit 3
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101483525 (elp3)
Transfer RNA biogenesis [BR:mze03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101483525 (elp3)
Chromosome [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101483525 (elp3)
   HAT complexes
    Elongator complex
     101483525 (elp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 553 aa AA seqDB search
MGKPKKKSDLSRAELMMMTIADVIKQLVEAHEKGKDINLNKVKTQASAKYGLEAQPRLVD
IIAAVPPQYRRALVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSD
FEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALPE
DYRDYFIRNLHDALSGHTSNNVAEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLGYG
CTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLAKDAGFKVVAHMMPDLPNVGMERDVE
QFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYTPSALVDLVARILALVPPW
TRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDMGTECRDVRTREVGIQEIHHKVRPYQ
VELIRRDYVANSGWETFLSYEDPEQDILIGLLRLRRCSPQSFRPELKGGVSIVRELHVYG
SVVPVSSRDPSKFQHQGFGMMLMEEAERIARDEHGSCKLAVISGVGTRNYYRKMGYELEG
PYMVKDLYRPGAD
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggggaagccaaagaaaaagagtgacctgagccgagccgagctgatgatgatgaccatt
gccgatgtcatcaagcagctggttgaagcccacgagaagggaaaagacatcaatcttaac
aaagttaagactcaggcctcagctaaatatggacttgaagctcagccccgactggtggat
atcatcgcagctgttccaccgcagtaccgtcgagcgctggtgcccaaactaaaggccaaa
cctatccgcactgccagcgggattgcagtcgtagctgtgatgtgtaaacctcatcgatgt
cctcacatcagctttacaggcaacatctgtgtctactgtcccgggggaccggactctgac
tttgagtactccacacagtcttacactggctacgagccgacttccatgagagccatccga
gctcgttacgacccctacctgcagaccagacatcgagtggagcagctgaagcagctgggc
cacagcgtcgacaaagtggagttcatcgtgatgggcgggaccttcatggctctgcctgag
gactacagagactacttcatcagaaaccttcacgacgccctgtcaggacacacctctaac
aacgtggctgaggctgtcaggtactcggagcgcagtaataccaaatgcgtggggatcact
atcgagacgcggcccgactactgcctgaagcggcacctcagcgacatgctgggctacgga
tgcacccggctggagataggagtccagagcgtctatgaagacgtggcccgcgacaccaac
agaggccacacggtgcgagctgtgtgcgagtctttccacctggcaaaggatgccggcttc
aaagtggtcgcccacatgatgccagacctgccgaacgtgggcatggagagggatgtggag
cagttcattgagttttttgaaaatccagctttcaggccagatggactgaaactgtacccc
accctggtcatccgaggcacgggtctgtacgagctgtggaagaccggccggtacaagagc
tacacgcccagcgctctggtggatctcgtggctcggattctggcgctggtgccgccctgg
acccgagtgtaccgagtgcaaagggacatccccatgccgctggtgagctctggtgtggag
cacggcaacctgagagagctggcactggccaggatgaaggacatgggcactgagtgtcgt
gacgtcagaacccgggaagtaggcatccaagagatccaccacaaagtccgaccttaccag
gtggagctgatacggagagactatgtggccaacagcggctgggagacctttctctcctat
gaagaccctgagcaggacatcctgatcggtctgttgcggctgcgccgctgctctccacag
tccttccgcccggagctcaaaggaggcgtgtccattgtccgtgagctgcacgtgtatggc
agcgtggtccctgtgagcagccgagacccgagcaagttccagcatcaggggtttggcatg
atgctgatggaggaggctgaaagaatcgccagggatgagcacggctcctgcaaactggct
gttatatcaggtgtaggaacaaggaactactacaggaagatgggctacgagctggaggga
ccgtatatggtgaaggacctgtaccggccgggagcggactga

DBGET integrated database retrieval system