KEGG   Maylandia zebra (zebra mbuna): 101485501Help
Entry
101485501         CDS       T02814                                 

Definition
alanine aminotransferase 2-like
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mze01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:mze01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mze01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mze00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 560 aa AA seqDB search
MSAARMQVLSSRNVRLLSRGRNEVFAGRSGAQRPGGDPRTRSLTCPPLSSSSSPGRALSS
LSATRRGLPKEKMSENGIMSRAKVLTIDTMNPTVKKVEYAVRGPIVQRAVELERELSEGM
KKPFAEVIKANIGDAHAMGQQPITFFRQVLALCSYPELLSDSTFPEDAKSRACRILQSCG
GNSMGSYSASQGIDSVRQDVARYIERRDGGVACDPDNIYLTTGASDGIVTMLKLLVCGEG
TTRTGVMIPIPQYPLYSAALAELGAVQINYFLNEEKCWSLDITELQRAVNEARQYCNPRA
LCIINPGNPTGQVQSRQCIEDVIRFAAKERLFLMADEVYQDNVYAEGCQFHSFKKVLFEM
GPEYAETVELASFHSTSKCYMGECGFRGGYMEIINMDDEVKDQLTKLLSVRLCPPVPGQA
LMDLVVNPPQPGEPSYGSFIKERTATLSALAEKAKLTEQVLNTVQGISCNPVQGAMYSFP
RITIPEKAVKEATETGQQPDMFYCMKMLEETGICLVPGSGFGQKDGTYHFRMTILPPTDK
LKILLNKVKEFHQRFTQQYS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccgctcggatgcaggtgctctcctccagaaacgtccggcttttaagccgcggg
cggaacgaggtgtttgccggtagaagcggagcgcagcggcccggcggagaccccaggacc
cgctcactgacttgtccccctctgtcatcctcctcttctcccggcagagccctatcgagt
ttgagtgcgacgcggcgtggacttcccaaagagaaaatgtccgagaatgggatcatgtcc
cgggccaaggtgctgaccatcgacaccatgaaccccacggtgaagaaggtggagtacgcc
gtgcggggacccatcgtacagcgcgccgtggagctagagagggagctctcagagggaatg
aagaagccctttgcagaggtcattaaggccaacattggtgacgcgcacgctatgggccag
cagccaatcactttcttccgacaggtcctggcgctctgctcctaccctgaactgctgagt
gacagcacattcccagaggatgctaaaagtagagcatgccgcattctgcagtcttgtggc
gggaacagtatgggttcctacagtgccagtcaaggcatagactctgtgcgtcaggacgtg
gcccgttacattgaacgacgggatggcggtgtggcctgtgacccagataacatttatctc
accacaggagccagcgacggcattgtgacaatgctgaagctgctggtgtgtggcgaaggt
acaacccgtaccggtgttatgatacccatacctcagtatcccctgtattcagctgcactg
gccgaactgggcgctgtgcagatcaactatttccttaatgaggaaaagtgctggagcctg
gacatcactgagctgcagcgtgctgtaaatgaggccaggcagtactgcaacccccgagcc
ttatgcatcatcaaccctggaaaccccacaggtcaggttcagagcagacagtgcattgag
gatgtaattcgattcgctgcaaaggaacgtctctttctcatggctgatgaggtgtaccag
gataatgtgtatgctgagggatgccagttccactcttttaagaaggtcctgtttgagatg
gggcccgagtacgcagaaacagtggaactggcgtctttccactcaacctctaagtgttac
atgggagagtgcggttttcgtgggggctacatggaaatcatcaacatggacgatgaagtg
aaggaccagctcaccaagctgctgtcagttcgtctgtgccctcctgttcctggtcaggct
ctaatggacctggtggttaaccctccacagcctggggaaccttcttatggcagctttatc
aaggaacgcacagccacattaagtgccttagcagaaaaggccaaacttacagagcaagtt
ctcaacacggtccaaggcatcagctgcaaccctgtgcagggtgctatgtactcctttcct
cgcataaccatccctgaaaaggctgtcaaagaggccacggaaacgggacagcagccagac
atgttttattgcatgaagatgttggaggaaacgggaatctgcctcgtacctggcagtggc
tttggccaaaaagatgggacctaccatttcagaatgaccatcttgccaccgaccgacaag
ctgaagatcctcctcaataaagtcaaagagttccaccagagattcacccagcaatattct
taa

DBGET integrated database retrieval system