KEGG   Maylandia zebra (zebra mbuna): 101485531Help
Entry
101485531         CDS       T02814                                 

Gene name
gys1
Definition
(RefSeq) glycogen synthase 1 (muscle)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101485531 (gys1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101485531 (gys1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    101485531 (gys1)
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101485531 (gys1)
Glycosyltransferases [BR:mze01003]
 Polysaccharide
  Storage polysaccharide
   101485531 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 711 aa AA seqDB search
MPLARSLSVTSLSGLEEWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTSEEWGE
NYFLVGPYVESNVRTQVELIEPTNPALRRTIDKMNSSGCKVYFGRWLIEGSPYVVLIDIA
FTAWSLDSGRASCGSFVPLACHGLTVRPTMRXLFGFLTAWLLGEFAAQCEQPAHIVAHFH
EWLAGLGLVLCRQRQLPVATIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYH
RYCIERAAAHCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KSRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDV
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVSKML
DKEDFTIMKRAIFATQRQCQPPICTHNMLEDSSDPILNCVRRIGLFNSSADRVKIIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPTAYGIYILDRRCRGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWKY
LGRYYIAARHMALAKAFPDTFIYEPQDTAQTAGFRYPRPASVPPSPALSRHSSPHHSEAE
DNEDDERYDEDLEAEKDKVNIRQPYTLPMKNKSIAIIGANGNGDEVTSEKN
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggctcgaagcctgtctgtcacgtccctgtcaggactggaggaatgggacgag
gagtttgatttagaggatgccgtcctttttgaaatagcctgggaggttgctaacaaagtt
ggaggcatctacaccgtcatccagaccaaagcccgtctgacctcagaggaatggggggag
aactatttcctggtgggtccctatgtggagagcaacgtgcgcactcaggtggagctgatc
gagcccacaaaccccgcactcaggcggaccattgacaagatgaactccagtgggtgtaag
gtctactttggccgctggcttattgaaggtagtccctacgttgtgctcattgatatcgcg
ttcaccgcctggtctttagactccggaagagcgagctgtgggagctttgttccattggcg
tgccatggtttgaccgtgaggccaacgatgcggntgctgtttggtttcctgaccgcttgg
cttctgggagagtttgcagcccagtgtgagcagcctgcgcacattgtggcccatttccat
gagtggctggcagggctggggctggtgttgtgtagacagagacagcttccagtggcaacc
atcttcaccacacatgctacactcctggggcgctacctgtgtgctggaaacgtggacttc
tataacaacctagcagagttcaatgtagacaaggaagcgggcgatcgacaaatctaccat
cgctactgtatagagcgtgcagcggcacactgtgcccacgtcttcaccacagtgtctcaa
attactgccattgaggctgaacacctgctcaagaggaaaccagatatcgtgactcccaac
gggctcaacgtgaagaagttctcagctatgcacgagtttcaaaacctccacgctcagagc
aagagtcggattcaggagtttgtcaggggacacttctatggacacctcgacttcaacctg
gacaagtgtttgttcctcttcatcgctgggaggtacgaattctccaacaaaggagccgac
atcttcttggaggctttagccagactcaattatctactgagagtcaaccacagtgacgtg
acagtgatcgcattcttcatcatgccagctcggacaaacaacttcaatgtggagaccttg
aagggccaagcagtcaggaagcagctctgggatactgctcagactgtgaaggagcgcttt
ggaaagaaactttatgagtcacttctggttgggcagctgccagatgtgtcgaagatgctg
gacaaagaggatttcacaatcatgaagcgcgccatctttgccactcagagacagtgccag
cctccgatctgcactcacaacatgctggaggacagcagcgaccccatcctcaactgtgtt
cgccgcattggccttttcaacagctctgctgaccgggtcaagattatcttccatcccgag
ttcctttcatccacctctcctcttcttccaatggactacgaggagtttgtaagaggttgc
caccttggcgtctttccctcttactatgagccctggggctacacacctgctgagtgcact
gtcatgggaattccatcaatctccactaacctgtcaggttttggctgtttcatggaggaa
cacatagcagacccaacggcatatggtatctacatcctggaccgcaggtgtcggggagtg
gacgagtcatgcaaccagctcacttccttcctgttccagttttgcaagcagagccgccgc
caacggatcatccagaggaaccgcactgaacgtctgagcgatctcttggactggaaatac
ctcggcaggtattatatagctgcccgccacatggccctggctaaagccttccctgacacc
ttcatatatgaacctcaggatacagcccaaaccgccggtttccgttacccccgaccagcc
tcagtgccaccatctccagccctgtcccgccactcctccccgcaccacagcgaggctgaa
gacaacgaagatgacgagcgctacgacgaggacctggaggccgaaaaggacaaggtgaac
atccgccagccctacacgctgcctatgaaaaacaagtccatcgccatcatcggggccaac
gggaatggcgacgaggtgacgagcgagaaaaactga

DBGET integrated database retrieval system