KEGG   Maylandia zebra (zebra mbuna): 101485531Help
Entry
101485531         CDS       T02814                                 

Definition
glycogen [starch] synthase, muscle-like
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101485531
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101485531
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101485531
Glycosyltransferases [BR:mze01003]
 Polysaccharide
  Storage polysaccharide
   101485531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 711 aa AA seqDB search
MPLARSLSVTSLSGLEEWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTSEEWGE
NYFLVGPYVESNVRTQVELIEPTNPALRRTIDKMNSSGCKVYFGRWLIEGSPYVVLIDIA
FTAWSLDSGRASCGSFVPLACHGLTVRPTMRXLFGFLTAWLLGEFAAQCEQPAHIVAHFH
EWLAGLGLVLCRQRQLPVATIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYH
RYCIERAAAHCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KSRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDV
TVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVSKML
DKEDFTIMKRAIFATQRQCQPPICTHNMLEDSSDPILNCVRRIGLFNSSADRVKIIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPTAYGIYILDRRCRGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWKY
LGRYYIAARHMALAKAFPDTFIYEPQDTAQTAGFRYPRPASVPPSPALSRHSSPHHSEAE
DNEDDERYDEDLEAEKDKVNIRQPYTLPMKNKSIAIIGANGNGDEVTSEKN
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggctcgaagcctgtctgtcacgtccctgtcaggactggaggaatgggacgag
gagtttgatttagaggatgccgtcctttttgaaatagcctgggaggttgctaacaaagtt
ggaggcatctacaccgtcatccagaccaaagcccgtctgacctcagaggaatggggggag
aactatttcctggtgggtccctatgtggagagcaacgtgcgcactcaggtggagctgatc
gagcccacaaaccccgcactcaggcggaccattgacaagatgaactccagtgggtgtaag
gtctactttggccgctggcttattgaaggtagtccctacgttgtgctcattgatatcgcg
ttcaccgcctggtctttagactccggaagagcgagctgtgggagctttgttccattggcg
tgccatggtttgaccgtgaggccaacgatgcggntgctgtttggtttcctgaccgcttgg
cttctgggagagtttgcagcccagtgtgagcagcctgcgcacattgtggcccatttccat
gagtggctggcagggctggggctggtgttgtgtagacagagacagcttccagtggcaacc
atcttcaccacacatgctacactcctggggcgctacctgtgtgctggaaacgtggacttc
tataacaacctagcagagttcaatgtagacaaggaagcgggcgatcgacaaatctaccat
cgctactgtatagagcgtgcagcggcacactgtgcccacgtcttcaccacagtgtctcaa
attactgccattgaggctgaacacctgctcaagaggaaaccagatatcgtgactcccaac
gggctcaacgtgaagaagttctcagctatgcacgagtttcaaaacctccacgctcagagc
aagagtcggattcaggagtttgtcaggggacacttctatggacacctcgacttcaacctg
gacaagtgtttgttcctcttcatcgctgggaggtacgaattctccaacaaaggagccgac
atcttcttggaggctttagccagactcaattatctactgagagtcaaccacagtgacgtg
acagtgatcgcattcttcatcatgccagctcggacaaacaacttcaatgtggagaccttg
aagggccaagcagtcaggaagcagctctgggatactgctcagactgtgaaggagcgcttt
ggaaagaaactttatgagtcacttctggttgggcagctgccagatgtgtcgaagatgctg
gacaaagaggatttcacaatcatgaagcgcgccatctttgccactcagagacagtgccag
cctccgatctgcactcacaacatgctggaggacagcagcgaccccatcctcaactgtgtt
cgccgcattggccttttcaacagctctgctgaccgggtcaagattatcttccatcccgag
ttcctttcatccacctctcctcttcttccaatggactacgaggagtttgtaagaggttgc
caccttggcgtctttccctcttactatgagccctggggctacacacctgctgagtgcact
gtcatgggaattccatcaatctccactaacctgtcaggttttggctgtttcatggaggaa
cacatagcagacccaacggcatatggtatctacatcctggaccgcaggtgtcggggagtg
gacgagtcatgcaaccagctcacttccttcctgttccagttttgcaagcagagccgccgc
caacggatcatccagaggaaccgcactgaacgtctgagcgatctcttggactggaaatac
ctcggcaggtattatatagctgcccgccacatggccctggctaaagccttccctgacacc
ttcatatatgaacctcaggatacagcccaaaccgccggtttccgttacccccgaccagcc
tcagtgccaccatctccagccctgtcccgccactcctccccgcaccacagcgaggctgaa
gacaacgaagatgacgagcgctacgacgaggacctggaggccgaaaaggacaaggtgaac
atccgccagccctacacgctgcctatgaaaaacaagtccatcgccatcatcggggccaac
gggaatggcgacgaggtgacgagcgagaaaaactga

DBGET integrated database retrieval system