KEGG   Maylandia zebra (zebra mbuna): 101486781Help
Entry
101486781         CDS       T02814                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101486781
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101486781
Enzymes [BR:mze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101486781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 850 aa AA seqDB search
MTSEWSEKSTADLMSRYVSKEMGYNVPKEGWRICLAHEFKEKRKPFQAKDVSLANIWGHI
GLGVRYLKFWYKKTQVEKKAPFIDMFGAQPLRQIYGAPLGGIGGGTITRGWRGEFCRWQL
NPGMYHYKTVIPNQFTVCLRREGKTVYQQVLSVERPPTLQGWNWGYCGEYAFYHALYPRA
WTVYDLPGQNVTLTCRQISPVIPHDYQDSSLPVAVLVWDIENKNEYDLDVSIMFTMVNGS
GQKDDKCGGHWNEPFHLEKEGEAVSGVLLHHCTAVNPYTLCIAAREQSDREISHQTAFSP
KGPCFSLWNDLIDDGRLDSPTGSSPPTVKGEKVAAAVAVGCSVPAQGHNSLEFCLAWDMP
KITFGSREKEHMRRYTRYFGTTGDASPSLSHYALTHYKQWEKSIEEWQRPILQDSSLPSW
YKSALFNELYFVADGGTVWTEIMEDVDISGGIRSEDGGLPAQPTVIKEYGRFAYLEGQEY
RMYNTYDVHFYASFALIMLWPKLALSLQYDIAGSVVQQDLTERLHLMSGLYSPIKTKNVV
PHDIGDPDDEPWVRVNAYLIHDTAHWKDLNLKFVLQVYRDFHLTQDRQYLQDMWPICQAV
MESELKFDLDGDGLIENSGYADQTYDGWIVTGPSAYCGGMWVASLCVMCKMARLLDSEEL
YRHYKDLLDRGSAAFEKLLWNGKYYNYDSSGRDLSNSVMSDQCAGHWFLRASGLGDGEFQ
AFPKEKIQSALKSVFDLNVMSFAGGQMGAVNGMRPEGVPDRSSVQSDEVWIGVVYGLAAT
MIHEGMQEEGMRTAEGCYRTVWEKLGMAFQTPEAYCEKNIYRSLAYMRPLSIWAMQLALN
TSQKDQTTTA
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagagtggagtgagaaatccacagcagacctcatgagcaggtatgtctccaag
gaaatgggatacaatgtgcccaaggaaggttggcgtatctgtctggcgcacgagttcaag
gagaagagaaagccctttcaagcaaaagacgtctctctggccaacatctgggggcatatc
ggccttggagtcaggtatctaaagttttggtacaagaagacgcaggtggaaaagaaggct
ccgttcattgatatgtttggtgcccaacccttacgccaaatctacggtgctccacttggc
ggcattggaggaggtaccatcacaagaggttggaggggggagttctgcagatggcaactt
aatcctgggatgtaccactacaaaacagtcatacccaatcagttcactgtgtgtttgcgt
cgtgaaggaaaaactgtttaccagcaggtgttatctgtagagcgtccacctacattacaa
ggctggaactggggctactgcggggagtacgccttctatcacgccttgtatcctcgcgcc
tggacggtttacgacctgccaggacagaacgtcaccctgacctgcagacagatttcccca
gtcatccctcatgattatcaggactcaagtctcccagttgcagtattggtgtgggacata
gagaacaagaacgagtacgatcttgatgtctcgattatgtttaccatggtcaacggatca
ggacaaaaggacgacaagtgtggcggacactggaatgaaccatttcacctggagaaggag
ggggaggcggtgtctggggtcctacttcatcactgtactgcagtgaacccttacactctg
tgcatcgcagcccgagagcagtctgacagggagatcagccaccaaacagcgttcagtcca
aagggaccctgcttcagtctgtggaacgacctcatcgatgatggacggctggactctcct
acaggatccagtccaccaacagttaaaggagaaaaggtagctgcggcagtagctgtgggc
tgctcggtgccagctcagggccataactcactggagttctgcttggcctgggacatgccc
aaaattacctttgggtctcgggagaaggagcacatgaggagatacactcgttactttggg
accacaggagatgcatccccctcactcagccattatgccctaacacactacaagcagtgg
gagaaaagcattgaggagtggcagagacccatactgcaggacagttctctaccttcctgg
tataagtcagcactgtttaacgagttgtactttgtggcggatggtgggaccgtgtggacg
gagataatggaggatgttgacatcagtggcggcatacgtagcgaggacggaggtctgcca
gctcaacccactgtcatcaaggagtatggacgtttcgcttacctagaaggtcaggagtac
agaatgtacaacacatatgatgtgcacttctacgcctcttttgcacttatcatgctgtgg
cccaaacttgccttgagtttgcagtacgacattgctggcagtgtggttcagcaagacctc
acggagagactccacctaatgagcggactttattctcccatcaaaaccaaaaatgtggtg
cctcatgacatcggagacccagatgacgagccctgggtgagggtgaatgcctacctcatt
catgacaccgcacactggaaggacctgaacctgaagtttgtcctgcaggtatacagggac
tttcatcttacccaggacaggcaatacctccaggacatgtggcccatctgccaggcagtg
atggagtccgagttgaaatttgacctggatggagatggcctaatagagaactctggatat
gctgaccagacctatgatggctggatagtgactggaccaagtgcctactgtggtggtatg
tgggtggcatcactctgtgtgatgtgtaaaatggccagactgttggacagcgaggagttg
taccgtcactacaaagacctgttggacagaggcagtgctgcttttgagaaactactgtgg
aacggcaaatactacaactatgacagcagtgggagagatctttctaacagtgtcatgtcg
gaccagtgtgctggccactggttcctgagagcatctgggctgggagacggagaatttcag
gcctttccaaaagaaaagatccaaagtgcactaaaatctgtgtttgacttgaatgtaatg
agctttgctggaggccagatgggggcagtcaatggcatgcgccctgaaggagtccctgat
cgctccagtgttcagtctgatgaagtgtggattggagttgtatacggtctggcagccaca
atgatccatgagggaatgcaggaggaaggtatgcgtacagcggagggctgctaccggacg
gtgtgggagaagctgggcatggcctttcagaccccagaagcctactgtgagaagaatatc
tatcgttctctagcctacatgaggcctctgagcatttgggccatgcagctcgccctgaac
acttcacagaaggatcagaccacaacagcttag

DBGET integrated database retrieval system