KEGG   Maylandia zebra (zebra mbuna): 101487369Help
Entry
101487369         CDS       T02814                                 

Definition
lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     101487369
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101487369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 78 aa AA seqDB search
MCKGLLSFIFQAICISISSVLSAGVCLTKHESNYNTKATNRNTDGSTDFGIFQINSRWWC
NDRRIRSANGCNIDCDGQ
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaaggactcttgtcctttatctttcaggcaatctgcatttccatctcttctgtt
ctgtctgcaggggtttgcctgaccaaacatgagtcaaactataacacaaaggcaacaaat
cgtaacactgatggatccactgacttcggcatctttcagataaatagccgctggtggtgc
aatgaccgccgcattcgttcagcaaatggatgcaacattgactgcgatggtcagtga

DBGET integrated database retrieval system