KEGG   Maylandia zebra (zebra mbuna): 101487871Help
Entry
101487871         CDS       T02814                                 

Gene name
pik3ca
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
Autophagy - animal
mTOR signaling pathway
Apoptosis
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101487871 (pik3ca)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101487871 (pik3ca)
   04370 VEGF signaling pathway
    101487871 (pik3ca)
   04068 FoxO signaling pathway
    101487871 (pik3ca)
   04070 Phosphatidylinositol signaling system
    101487871 (pik3ca)
   04150 mTOR signaling pathway
    101487871 (pik3ca)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101487871 (pik3ca)
  Cell growth and death
   04210 Apoptosis
    101487871 (pik3ca)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101487871 (pik3ca)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101487871 (pik3ca)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101487871 (pik3ca)
  Endocrine system
   04910 Insulin signaling pathway
    101487871 (pik3ca)
   04914 Progesterone-mediated oocyte maturation
    101487871 (pik3ca)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101487871 (pik3ca)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101487871 (pik3ca)
Membrane trafficking [BR:mze04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101487871 (pik3ca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1068 aa AA seqDB search
MPPRPSSGELWGIHLMPPRILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDSEVQDFRRNILNVCKDSVELRDASGPHSRALYVYPPNVESTQELPKH
IYSKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSPEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPISQYKYIRSCIMLGRMPNLMLMAKDSLYTQLPTD
NFVMPSYSRRISTATSYMNGEAAAKSLWTINGTLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQMCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNVNLFDYTHTLVANKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDHF
SSPVKYPDMNAVEDHANWTISRELGFNYNLSGQSNRVARDHALTESDTEQLRQLSNRDPL
SEITEQEKDFLWRHRHYCMNIPEILPKILLAVKWNSRDEVAQMYCLLKEWPSIRPEQAME
LLDCNYPDPMVRHFAVRCLDKYLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLEAYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMRFLVEQMKRPDYMDALQNFTSPLNPAHQLGNLRLDECRIMSSAKRPLW
LNWENPDIMSEMLFQNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLS
LGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSNTLHQWLKDKNKGEMYDMAVDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGSQECAKTKEFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALEKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHALN
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaggccatcctcaggggagctatggggcatccacctgatgccccccaggatt
ctggtggactgccttctgcccaatgggatgattctgaccctggagtgtctccgtgaggcc
acgctcatcaccatcaaacatgagctgtttaaggaggcccgaaaatatcctctccatcac
ctcttacaggaagagacatcctacatcttcgtcagcgttacacaggaagcagagcgggag
gagttctatgatgaaacccggaggctgtgcgacctccgactctttcagcctttcctcaag
gtcattgaaccagttggcaacagagaggaaaagatcctcaacagagagattggtttcgcg
attggtatgcctgtgtgtgagtttgaccttgtgaaggactctgaggttcaggacttcagg
agaaacatcctgaatgtttgtaaagactctgtggagctgagagatgccagtgggccccac
agcagagcgctgtacgtttacccacctaatgtagagtcaacacaggaacttcccaaacac
atctatagcaaactggacaaaggtcaaattattgttgtaatatgggtgattgtttctcca
aataatgacaagcaaaagtacacactgaagatcaaccacgactgtgtgcctgaacaggtg
attgcagaggccattcgtaagaagacacgaagcatgctgctgtccccagagcagctaaag
atgtgtgttcaggaatatcagggtaaatacatcctcaaagtctgcggctgtgacgagtac
ctgctggaaaagtaccccatcagccagtacaagtatatccgtagttgcatcatgctgggc
aggatgcctaacctgatgctaatggctaaggacagcctgtacacccaattgcctacagat
aactttgtcatgccatcatattcccgacgcatctccacggcaacatcgtatatgaatggg
gaggcagctgccaagtctctgtggaccatcaacgggactctacgaatacgaatcctgtgt
gccacctatgttaacgtcaatatacgggacatagacaagatatatgtgaggacaggcatt
taccatggaggtgaacagatgtgtgacaatgtaaatacacagagggtaccctgctctaat
cccaggtggaatgagtggcttacgtatgatatgtacatcccagacatcccccgtgctgcc
agactctgcctttctatctgctctgtcaagggcagaaagggagccaaggaggagcattgt
ccactagcatggggtaatgtcaacttgtttgattatacacacacgctggtggccaacaag
atggctctgaatctctggcctgtcccccatggtcttgaagacctcctgaaccccatcgga
gtcactgggtcgaacccaaataaggaaacaccatgtctagagctggagtttgaccacttt
agtagtcctgtcaaatacccagacatgaatgcagtggaagatcacgcaaactggaccatc
tcaagggaactagggttcaactacaacctctcagggcagagcaatcgagtggccagagat
cacgccctcacagagagtgacaccgagcagttgagacagctgagtaacagagaccctctg
tcagaaatcactgagcaggagaaagactttctctggagacacaggcactactgcatgaac
atcccagagatccttcccaagatccttctcgcggtcaagtggaactccagagatgaagta
gcacagatgtactgtctgttgaaggagtggccgtctatccgtcctgagcaggccatggag
ttgctggactgtaactatccagaccccatggtcaggcactttgctgtacgttgccttgac
aaatacctgactgatgacaaattgtcccagtacttgatccagcttgtacaggttttaaaa
tacgagcagtatcttgacaatcccctggcccgttttctcctcaaaaaggccctgaccaat
cagagaataggacatttcttcttctggcatctcaagtcagaaatgcacaataaaacagtg
agccagaggtttgggctgctgttagaggcttactgccgtgcttgtggcatgtacctaaaa
cacctcagcaggcaagtagaggccatggagaagctcataaacctcaccgacatcctcaaa
caggagaagaaggatgagacgcagaaggttcagatgcggtttcttgtggaacagatgaag
aggccagactacatggatgccctgcagaactttacgtctcctctaaaccctgcgcatcaa
cttggaaacttgaggttagatgaatgcaggattatgtcgtcagcaaagaggcctttgtgg
ctgaactgggaaaatcccgacatcatgtctgagatgctctttcagaacaatgaaatcatc
ttcaaaaatggagatgacttgcgccaggacatgctgacattgcagattattaagatcatg
gagaacatttggcagaatcagggactggacctacggatgttgccctatggctgcttgtca
ttaggagattgcgtgggtctcattgaggtggttcgcaactcccacaccatcatgcagatt
cagtgtaaaggaggcttgaaaggggcactgcagttcaactcgaatactctgcatcagtgg
ctcaaggacaagaacaagggcgagatgtatgacatggctgtagatctgttcacaaggtct
tgtgctggctactgtgtagctacatttatccttgggataggagacaggcacaacagcaac
attatggtcaaagatgatggacagttatttcatatagattttggccatttcctggatcat
aagaaaaagaagtttggctacaaaagagagcgagtgccctttgttctgacacaagacttt
ctcatcgtcatcagcaaaggatcccaggagtgcgcaaagaccaaagagttcgaaaggttt
caggagatgtgttataaagcctacctagccatcaggcagcacgccaacctcttcatcaac
ctgttctccatgatgctcggctctggcatgcctgagctgcagtcatttgacgacattgcc
tacattagaaagacgctggcactggagaaaacagagcaggaggcactggactatttcatg
aagcagatgaatgatgctcaccatggagggtggaccaccaagatggactggatattccac
acaattagacagcatgcactaaactga

DBGET integrated database retrieval system