KEGG   Methanosalsum zhilinae: Mzhil_0063Help
Entry
Mzhil_0063        CDS       T01541                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mzh  Methanosalsum zhilinae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mzhil_0063
Enzymes [BR:mzh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Mzhil_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
70444..71679
Genome map
AA seq 411 aa AA seqDB search
MAVDADICGLKIGDKHPVRLMGVINLSNESFYKASVVDEDSVLDVARKMVDEGATMIDVG
ARSTWPLAKPISRNKEISRLLPVLDILQNNVDAIVSVDTMFSDIAEKALSRGVDVVNDVS
GFTTDPGMMCVVRDYDCPAVVMASMERTGDPLGMDEVIIALDEIVRRSESHGIDPSRLIL
DPAIGKWVPEKEAVHDFEVIDQFQRLQVFEKPILAAISRKSVIDAVVNKPADERLHGSLA
ATAITVHKGAHIIRTHDVAATVDAVKVASAMRSFPSATQEDRFRVSIIDITVPDDLVYYM
RSVGVTPEGCSIMKNKSVSMAIRIDNITSTEALIIKQEILARGGDAAISRDAISQQLDST
DVIVIGTLLQFEKLIQKLSGQSRDLPLIARMLRRTLESQIDIKQKYPGTTL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgatgcagatatttgtggccttaagattggagataaacatcctgtaagactt
atgggtgttatcaatctgagtaacgaatccttttacaaagcatcggtagtagatgaagat
tccgtccttgatgttgccagaaaaatggttgacgaaggtgctaccatgattgatgtggga
gccagatccacctggcccctggcaaagcccatctccagaaataaagaaatttcacgcctg
ctcccagttctggatattcttcagaataatgtagatgcaattgtttctgtggataccatg
ttctcagatattgctgagaaggctttaagcaggggggtggatgttgtaaatgatgtatcc
ggatttaccactgatcccgggatgatgtgtgttgttagagactacgactgccctgcggtg
gtgatggcttccatggaacgtacgggagacccactgggtatggatgaagtcataatcgca
ctggatgaaattgttcgcaggtcagaatcgcacggaatcgatccttccagacttattctg
gatcctgcaattggaaaatgggtccctgaaaaagaggcagtacatgattttgaagtgatc
gatcagttccagagactgcaggtatttgaaaagccaatacttgctgccatttcaagaaaa
tcagtaatagatgcagttgtaaacaaacctgcggatgaaagacttcatggaagccttgcg
gcaactgcaattaccgtacataaaggagcacatatcatacgcacacatgacgtagctgcg
acagttgatgcagtcaaagtggcttcggcaatgcgcagctttccttcagctacacaggaa
gatcggttcagggtaagtattattgatatcactgttccagatgacctggtttactatatg
cgatcagtaggagttactcccgaaggctgcagtatcatgaagaataaatccgttagtatg
gctatcaggatcgataatattacctctactgaagcccttattatcaagcaggagattctt
gcaagaggtggtgatgcagcaatatccagagacgccatatcccagcaacttgacagtaca
gacgttatagtcataggcactcttctgcagtttgagaagctgatacagaaactatcaggc
cagtcacgggatcttcccctgatagcccggatgctcaggagaaccctggaaagccagatt
gacatcaaacaaaaataccctggaacaacattatga

DBGET integrated database retrieval system