KEGG   Methanosalsum zhilinae: Mzhil_0528Help
Entry
Mzhil_0528        CDS       T01541                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mzh  Methanosalsum zhilinae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mzhil_0528
Enzymes [BR:mzh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mzhil_0528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(579753..580808)
Genome map
AA seq 351 aa AA seqDB search
MKDLQKLLEKLSNTHGISGYEGNVRTVMEDELREYADEIRTDKMGNLIATSYGSGPSVMI
AAHMDEIGLMVKYIDENGFLRFVKIGGWFDPTIHSQRVIVHTVNGPVKGVVGCKPPHVMK
EEERKKPPKAEDMFIDIGVTSKEEAEKLGVEVGSPISVDREFAALENNRVTGKAFDDRAG
VAMVIQVMKEISRMELNVTVHAVGTVQEEVGLKGAKVSAFGLNPDVAIITETTISGDYPG
IDKKDSAIEVGKGPAITIVDAAGRGLIADQGVIKWLKETARQHNIPYQLDVADGGTTDAT
AIHLTKEGIPSGVVSVPTRYIHSPVEVISMEDLSSCVELVVKAIENIDTYL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatcttcagaaattattagagaaactatccaacacccatggtatatcagggtat
gaaggcaatgtcagaacggttatggaagatgaactgcgcgaatatgcagatgagatacgt
acagacaaaatgggaaatctcatagcaacaagctatggttccggtccatcggtaatgatt
gcagcacatatggatgagattggtcttatggtcaagtacatagatgaaaacggatttttg
agattcgttaaaatcggaggatggtttgatcccactatccacagtcagagagtgattgtc
cacacggttaacggacctgtcaaaggcgtggtgggatgcaaaccacctcatgtaatgaaa
gaggaagagagaaaaaaacctccaaaagctgaagacatgtttattgatattggagtgaca
agcaaagaagaagcagaaaagcttggagtagaggtcggttcaccaatttcagttgacaga
gaatttgcagcccttgaaaacaaccgtgtaacaggtaaggcctttgacgacagggctggt
gtagcaatggtaattcaggtaatgaaagaaatctcgagaatggaactgaatgttacggtc
catgccgtgggtacggtacaggaagaagtcggcttaaaaggtgcaaaagtatctgctttt
ggcctgaatccggatgttgccattataactgaaacaacaatttcaggagattatccaggg
attgataaaaaggactctgcaattgaggtagggaagggacctgccatcaccattgtggac
gcagcaggaagaggccttattgcagaccagggagtaataaagtggttaaaagagactgcc
cgacagcacaatattccttaccagctcgatgtagcagatggaggaacaaccgatgccaca
gccatacaccttacaaaagaagggatcccttctggtgttgtaagcgtacctacaagatac
atccattcacctgttgaagttatcagcatggaagatctcagctcatgtgtggaacttgta
gtaaaagcaattgaaaatattgacacttacctttga

DBGET integrated database retrieval system