KEGG   Methanosalsum zhilinae: Mzhil_0540Help
Entry
Mzhil_0540        CDS       T01541                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mzh  Methanosalsum zhilinae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mzh01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mzh00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mzh00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(587636..588418)
Genome map
AA seq 260 aa AA seqDB search
MRISDKFEELKSRNEGALISYICAGDPSTELTKSAVEALVRGGADIIELGLPFSDPCADG
PVIQSATDRAISAGMTPDRYFELVSTLQVDIPLVCMTYYNIIYKRGIEKFIEDCSSSGIT
GLIVPDLPVEESDELGLACEKNEVDLIFLIAPTTNKKRLQKILSKSTGFLYMVSRTGVTG
GSTDINTGIADLLTDIKKCANIPIAVGFGISNRNQVVDIISYGADGVIAGSAFVDIIASG
KNVEHRLESLVFDLKSGCKE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagaatatctgataaattcgaagagctaaaatcaagaaatgaaggtgccctgatatcc
tatatctgtgcaggagatccatctactgaattgacaaaatctgcagttgaagcattggta
aggggtggagcagatatcattgaactcgggcttccattttccgatccctgtgccgacggg
cctgtaatacagtcagcaacagatagagcaatatcagcaggaatgacacctgacagatat
tttgaacttgtgtctacccttcaggttgatattccacttgtctgtatgacatactacaat
ataatatacaaacgcggtattgaaaaatttatagaagactgttcttcttccggtataaca
ggtcttattgtcccagatctgcctgttgaggaatctgatgaactcgggctcgcgtgtgaa
aagaatgaagtggacctgatattccttatagcaccaacaacaaataagaaaaggcttcag
aaaatactttctaagagcacaggctttctatatatggtatcccggacaggcgtcacaggt
ggaagtactgatatcaatactggtatagcagatctgcttacagatatcaaaaagtgcgca
aatatccccattgcagtcgggtttggcatatcaaaccgcaatcaagtagtggatattatt
tcatacggagccgatggagttattgcgggatctgcatttgtagatattattgcatcagga
aaaaatgttgaacaccgtcttgagtcactggtatttgatctgaaaagtggatgcaaagag
taa

DBGET integrated database retrieval system