KEGG   Methanosalsum zhilinae: Mzhil_0675Help
Entry
Mzhil_0675        CDS       T01541                                 

Definition
AMP phosphorylase (EC:2.4.2.4)
Orthology
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
mzh  Methanosalsum zhilinae
Brite
Enzymes [BR:mzh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Mzhil_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
739800..741320
Genome map
AA seq 506 aa AA seqDB search
MQLKVQPIDIKVGKYKVVLNSIDAKELGVIEGDRVRVRNHESLTAIVDFTEDMIPPGMIG
VYHELQQKLNKQWTETVEVTPASRPKSARLIRKIMDRQILTKDEIYEIVRGIVDESLSDI
ELSAFITSTYINDLTDDETEWLTRAMIDTGEKIEFDSHPIMDKHSIGGVPGNKISLLIVP
IVAANGLLIPKTSSRAITGAGGTADLMEVLAPVDFSASEIKEMTEKVGGVLVWGGGTNIA
PADDKLIKIEYPLKVDPHSQLLASIMAKKGAVGADHVVMDIPMGAGTKIPDIKTGRKLSR
DLINLGERLGMTVECALTYGSSPVGRTVGPALEVREAFRVLESMEGPNSLIEKSTVIAGM
MLEMGGIAGKGNGQELAMETLKNGKALEKMKQIIEVQGGDPGVTSADIIIGEHSIQLFAP
TNGYILEFDNKRIVEIARIAGAPADKGAGVVIHKKRGEPVKKNEPVLTIYSEKKWKLDNA
IKSAQLNLPIVVEGMLIERVPTYREL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaaaagttcagccaattgatatcaaagtaggaaaatataaagtagttctcaat
tcaatagatgcaaaggagcttggtgtcattgaaggagatcgtgtaagagttagaaatcat
gaatctttgactgcaattgttgattttacggaggatatgattcctccgggtatgatcggt
gtctaccatgaactgcagcagaagctcaataaacagtggactgaaacagtggaagtaact
cctgcttcccgtccaaaatctgcccgacttattagaaagataatggacagacagattttg
acaaaagatgagatatatgagatcgtaaggggaattgttgatgagagccttagtgatatt
gaactgtcagcatttattaccagtacctacataaacgaccttactgatgatgaaactgaa
tggttgacaagagctatgatagataccggggaaaaaatagagtttgactctcatccaata
atggataagcattcaattggaggtgttccagggaacaaaatatctctgctgatcgttcct
attgtagctgcgaatggattactgatccctaagaccagctcccgtgctataacaggcgcg
ggtggcactgcagatttgatggaagtactggcaccagtggactttagtgcatctgaaata
aaagagatgactgaaaaggttggtggagtacttgtctggggtggtgggacaaacattgct
cctgcagatgataaattgatcaagattgaatatccgctcaaagttgatccccattcccag
ctgcttgcttccataatggcaaaaaaaggtgcagtaggtgctgatcatgttgtaatggat
atcccgatgggtgccggtaccaagattcctgatatcaaaaccggaagaaaactatccagg
gacctgataaaccttggtgaaagactggggatgacagtagaatgtgcactgacctatggt
tcttcacctgtaggtcgaactgtaggccctgcacttgaggtacgagaggccttcagggtg
ctggaatctatggaaggtccaaacagcctgattgagaagagtacagtgattgcaggaatg
atgctggagatgggtggtattgctggtaaaggtaatggacaggaacttgcaatggaaacc
ctcaaaaatggaaaagcccttgaaaaaatgaaacagataatagaagttcaggggggagat
cctggggtcacttctgcggacataataataggggaacattccattcagctttttgcaccc
acaaatggatatattctggaatttgacaataagaggattgtggagattgcaagaatagcc
ggtgctccggcagataaaggagcaggtgttgtaatccacaaaaaacgtggtgaaccggta
aagaaaaatgaacccgtcctgactatttattccgaaaagaaatggaaactggataatgct
atcaagagtgcacaactaaatctcccaattgttgtcgaaggaatgctgatcgaacgagtc
cccacttacagggaactttaa

DBGET integrated database retrieval system