KEGG   Methanosalsum zhilinae: Mzhil_0751Help
Entry
Mzhil_0751        CDS       T01541                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00030  Pentose phosphate pathway
mzh01100  Metabolic pathways
mzh01120  Microbial metabolism in diverse environments
mzh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mzhil_0751
Enzymes [BR:mzh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Mzhil_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C
Motif
Other DBs
NCBI-ProteinID: AEH60615
UniProt: F7XKL2
Position
822414..824165
Genome map
AA seq 583 aa AA seqDB search
MTDISDMSNVLYIDLTEKTFEKVSRKDLYRKYLGGTGVATALFFEEFKDGMDPLDPRAPV
VFSIGPLSALFPSCSKVVSMFRSPLTNELGESHAGGRLALAMRFSGCDSIVIKGRAKKPV
YISIHDDEVLFKDASSIWGLSSTTDVGKIIREVEPGAGRRSIIRIGIAGEKLVKYSNVNV
DTYRHFGRLGLGAVFGSKNLKAIVISGNKEIEVSDKKAYNLTFKQIYEEIVKTDQMHKYH
DLGTTENILPLNEIKGLPTKNFQHSSFEFSESISGELFAEKYLIKRVSCAVCPIGCVHIA
MLKKRFSRLHEYEIKNISYDYEPVYSMGTILGVQSPEGILELIDKCEMYGLDVISTGVVL
AWATEMFQLDRIPESEKGGLNLRWSDVDSYLQAIDLIVGGTTDFYSAMGKGINYAAKEYG
GEDFAMQIGGLEVAGYHTGPANIAGLAVGVRHSHLDNAGYSIDQKSLKKRLGEEDIADLL
IYEDNIRSIFNSLTICLFARSVYSPDTIKAALGSLGIHADEETLNSLGNDIVMKKYELKK
RMGFDLKDLRFPERFFETVSSTGTVNRDSVEQIIRIYCLKRGI
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgactgatatttcggatatgtcaaatgtcctctacattgatcttacagaaaaaacattt
gaaaaagtaagccgaaaagatctctacagaaaatatcttggtggtactggagtagctact
gctcttttttttgaagaattcaaagatggaatggatccactggacccccgggcacctgta
gtattcagtataggccctctatctgcattgtttccaagctgttcaaaagttgtctcaatg
tttagatctcctctcaccaatgaactgggtgaatcacacgcaggaggacgtcttgctctg
gcaatgagattttcaggctgtgactcgattgtaataaagggtagggccaaaaagcctgtt
tatatttcaatacatgatgatgaagtattgttcaaagatgcgtcttctatatggggtctc
tcatcaactacagatgtggggaagataattcgcgaggttgaaccaggagccgggcgcagg
agtattatccgcataggtattgcaggagagaaactggttaaatattccaatgtcaatgtt
gatacttataggcattttggtagactgggtctgggagctgtttttggatcaaagaatctt
aaagctattgtgatctccggtaataaggaaatagaggtatctgataaaaaagcctataac
ctaacatttaagcaaatttatgaagaaattgtaaaaaccgaccagatgcataagtatcat
gatctgggaactactgaaaatattctccctctcaacgaaatcaaagggttgccaacaaaa
aatttccaacattccagttttgaattctcagaatcaatatctggggaattgtttgcagaa
aaatatcttataaaaagagtgtcctgtgcagtgtgtcctatcggatgtgtgcatatagct
atgcttaagaagagattttccaggcttcatgagtatgaaataaagaatatttcatatgac
tatgaacctgtgtattcaatgggtactatcctgggagtacagtctcctgaaggaatactt
gaactgatagataaatgtgaaatgtacggactggatgtcatcagcacaggagttgtactg
gcatgggctacggaaatgtttcaacttgatcgaatacctgaatctgaaaagggcggactt
aacctaaggtggtccgatgttgatagctatctgcaggctattgatcttattgtaggtgga
actactgatttttattcagcaatggggaaaggtataaattatgcagctaaggaatatggt
ggtgaagatttcgctatgcagattggtgggttggaagttgcaggttatcatacaggccct
gcaaatatagcaggccttgctgtaggggtcagacactctcatctggataatgcaggatac
agcattgatcagaaatctcttaagaaaaggcttggtgaggaggatatagctgatctgttg
atatatgaggataacattcgcagtatcttcaattcacttactatatgtctgtttgcacgt
tcagtatattcccctgatactataaaggcagcattgggatctctgggaattcatgctgat
gaagaaactttaaattctcttggtaatgatattgttatgaaaaagtatgaactaaaaaaa
agaatgggctttgaccttaaagatcttcgttttccggaaagattctttgaaaccgtatca
tctaccggaactgttaaccgggacagtgtagagcaaattatccggatatactgtttgaag
cggggaatctga

DBGET integrated database retrieval system