KEGG   Methanosalsum zhilinae: Mzhil_0843Help
Entry
Mzhil_0843        CDS       T01541                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mzh  Methanosalsum zhilinae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mzhil_0843
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mzhil_0843
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mzhil_0843
Enzymes [BR:mzh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mzhil_0843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
920071..921279
Genome map
AA seq 402 aa AA seqDB search
MYNLECIDCGNKYSKSDVVYTCKCGGLLDIIYDYANINIDMEKLKYEPPTVWKYRDLLPI
TGNPVTIYEGGTPLYRCDRLAEKIGVKELYVKHEGLNPTGSFKDRGMTVGVSKAIELGMK
TVACASTGNTSASLAIYGAKAGIPAIVLLPEGKVAMGKVAQALMHGAKVLSIRGNFDEAL
ALVRTLCDQEKFYLLNSINPYRLEGQKTIGFEIVDQLGLKVPDRVVLPVGNAGNITAIYK
GFKEFRELKITDTVPKMCGIQAEGASPIVQAIKSGAESIIPESNPETIATAIRIGDPVNA
KKALNAIRESEGTAETVTDEELVQAQRDLAQLEGIGVEPASATSVAGLRKLVEAGVIGSE
ETVVCVTTGHLLKDPQEVIDACDRPILVDATIEAIRDVVFPK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtataatttagaatgtatagactgtggaaacaaatattcgaaatcagatgtcgtttat
acctgtaaatgcggtggtcttcttgatataatttatgactatgctaacataaatattgat
atggagaaattgaaatatgaacctcctacagtttggaaataccgtgatctacttccaata
accggtaatcctgtaactatttatgaagggggtacacctctttatcggtgcgatcgcctg
gctgaaaagattggagtaaaggaattatatgtaaagcatgagggattgaatcccacaggt
tcttttaaggataggggaatgactgttggtgtatctaaagcaattgaacttggcatgaag
actgttgcatgtgcttcaacaggaaacacatctgcttcacttgcgatttacggagcaaag
gctggaattcctgcgattgttctattgcctgagggaaaagtagcaatgggaaaggttgca
caggcattgatgcatggtgcaaaggtcttgagcattaggggaaattttgatgaggcactt
gctcttgtgcgaacattatgtgatcaggaaaagttctatcttttaaattccatcaatccc
tataggctggaggggcagaaaacaatcggattcgagatcgtagaccaacttggactcaag
gttccagacagggtagtccttccagttggaaatgcaggcaacattactgccatctataaa
ggattcaaagagtttagagaattgaagataacggatactgtaccaaaaatgtgtggtatt
caggcagagggtgcatccccgattgtacaggctataaagagtggtgcagaatctattatt
ccagaatcaaatccagaaactatagcaactgcaatacgtataggagatccggtaaacgca
aagaaagccctcaatgcaataagggaatcagaagggactgctgaaacagttacggatgaa
gaacttgttcaggcccagcgagatcttgcacagctggaaggtattggtgtggaacctgca
agtgcaacatctgttgcaggactccggaaacttgtagaggctggtgttataggtagtgaa
gaaacggttgtatgtgtcacaacaggtcatctgctaaaagatcctcaggaagtcattgat
gcatgtgaccggcctatactggtggatgcaactattgaagcaataagggatgtcgtgttt
cccaaataa

DBGET integrated database retrieval system