KEGG   Methanosalsum zhilinae: Mzhil_1366Help
Entry
Mzhil_1366        CDS       T01541                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mzh  Methanosalsum zhilinae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mzhil_1366
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mzhil_1366
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mzhil_1366
Enzymes [BR:mzh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mzhil_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1479656..1480960)
Genome map
AA seq 434 aa AA seqDB search
MESTKIILDENEMPQKWYNILPDLPNPLDPPLNPATNEPIKIEELEPIFAGELIKQELSS
DRYISIPEEILDIYRMWRPSPLYRAKKLEDILKTPAKIYYKYEGVSPPGSHKPNTSIAQA
YYNMKEGTERLTTETGAGQWGSSLSFACNYFDLECKVYMVRSSFEQKPYRKSLINLWGGS
VVPSPSNETNFGRKILKEFPDTTGSLGIAISEAVEDAAINDNTKYTLGSVLNHVMLHQTI
IGLEAQKQMEMAEDYPDIIIGCCGGGSNLAGISFPFIKDKLDGKSDVKVVASEPSACPTL
TKGQFRYDFGDTAETTPLLKMYTLGHEFIPPAIHAGGLRYHGDSPIVSKLVDEGLIDAIS
YHQIEIFDAAIMFARTEGIAPAPEASHAIKAAIDEAVRCRKTGEEKTILFNLSGHGHFDM
SSYDRYFSKKLSDD
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaacaaaaatcatacttgatgaaaatgaaatgccgcagaagtggtataacatt
ttaccagatctgcctaaccctcttgatcctccattaaacccggcaaccaatgaaccaata
aaaatcgaagagctggagccgatttttgctggagaactaattaagcaggaattaagcagt
gatagatatatttctattcctgaagaaatacttgatatataccgtatgtggagaccatct
ccgctttacagggcaaaaaaacttgaagacattctcaaaacgcctgcaaaaatatattat
aaatatgaaggcgtaagtcctcctggtagtcacaaacccaatacttcaattgcccaggca
tattataatatgaaagaaggaactgaaaggttgactacagaaacaggagcaggtcagtgg
ggcagctcactttcatttgcatgtaattactttgatcttgaatgcaaggtgtatatggta
aggtcaagttttgaacaaaaaccataccgtaaatcactcataaacctgtggggcggatct
gttgtaccctctccaagcaatgaaaccaattttggaagaaaaatcctgaaagaattccca
gataccacaggaagtcttggtattgctataagtgaagctgtagaggatgcagcaatcaat
gataatactaagtatactcttggtagtgtcttgaatcatgtgatgctccatcagacaatt
attggtcttgaagcccaaaaacagatggaaatggctgaagactatccggacatcattatt
ggatgctgtggtggcggcagcaatcttgctggtatcagctttccgtttatcaaagataaa
ctggacggaaaaagtgatgtaaaagtagttgcttcagaaccatctgcatgcccaaccctt
acaaaaggacagttcaggtatgactttggggatactgctgagaccacacctttgcttaaa
atgtatacacttggccatgagttcataccccctgcgatccatgcaggcggactgagatat
catggtgattccccaatcgtaagcaaacttgtggatgaggggcttatagatgcgatttca
tatcatcagattgagattttcgatgcagcaataatgtttgcaaggactgaaggtatagca
ccagctcctgaagcatcacatgcaataaaagctgctatcgatgaagctgtaaggtgcagg
aagaccggggaagagaaaacaattctgttcaatctgagtgggcatggacactttgatatg
tcctcctatgataggtatttctcaaaaaagctcagcgatgattga

DBGET integrated database retrieval system