KEGG   Methanosalsum zhilinae: Mzhil_1366Help
Entry
Mzhil_1366        CDS       T01541                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00260  Glycine, serine and threonine metabolism
mzh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mzh01100  Metabolic pathways
mzh01110  Biosynthesis of secondary metabolites
mzh01130  Biosynthesis of antibiotics
mzh01230  Biosynthesis of amino acids
Module
mzh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mzhil_1366
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mzhil_1366
Enzymes [BR:mzh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mzhil_1366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEH61210
UniProt: F7XNF8
Position
complement(1479656..1480960)
Genome map
AA seq 434 aa AA seqDB search
MESTKIILDENEMPQKWYNILPDLPNPLDPPLNPATNEPIKIEELEPIFAGELIKQELSS
DRYISIPEEILDIYRMWRPSPLYRAKKLEDILKTPAKIYYKYEGVSPPGSHKPNTSIAQA
YYNMKEGTERLTTETGAGQWGSSLSFACNYFDLECKVYMVRSSFEQKPYRKSLINLWGGS
VVPSPSNETNFGRKILKEFPDTTGSLGIAISEAVEDAAINDNTKYTLGSVLNHVMLHQTI
IGLEAQKQMEMAEDYPDIIIGCCGGGSNLAGISFPFIKDKLDGKSDVKVVASEPSACPTL
TKGQFRYDFGDTAETTPLLKMYTLGHEFIPPAIHAGGLRYHGDSPIVSKLVDEGLIDAIS
YHQIEIFDAAIMFARTEGIAPAPEASHAIKAAIDEAVRCRKTGEEKTILFNLSGHGHFDM
SSYDRYFSKKLSDD
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaacaaaaatcatacttgatgaaaatgaaatgccgcagaagtggtataacatt
ttaccagatctgcctaaccctcttgatcctccattaaacccggcaaccaatgaaccaata
aaaatcgaagagctggagccgatttttgctggagaactaattaagcaggaattaagcagt
gatagatatatttctattcctgaagaaatacttgatatataccgtatgtggagaccatct
ccgctttacagggcaaaaaaacttgaagacattctcaaaacgcctgcaaaaatatattat
aaatatgaaggcgtaagtcctcctggtagtcacaaacccaatacttcaattgcccaggca
tattataatatgaaagaaggaactgaaaggttgactacagaaacaggagcaggtcagtgg
ggcagctcactttcatttgcatgtaattactttgatcttgaatgcaaggtgtatatggta
aggtcaagttttgaacaaaaaccataccgtaaatcactcataaacctgtggggcggatct
gttgtaccctctccaagcaatgaaaccaattttggaagaaaaatcctgaaagaattccca
gataccacaggaagtcttggtattgctataagtgaagctgtagaggatgcagcaatcaat
gataatactaagtatactcttggtagtgtcttgaatcatgtgatgctccatcagacaatt
attggtcttgaagcccaaaaacagatggaaatggctgaagactatccggacatcattatt
ggatgctgtggtggcggcagcaatcttgctggtatcagctttccgtttatcaaagataaa
ctggacggaaaaagtgatgtaaaagtagttgcttcagaaccatctgcatgcccaaccctt
acaaaaggacagttcaggtatgactttggggatactgctgagaccacacctttgcttaaa
atgtatacacttggccatgagttcataccccctgcgatccatgcaggcggactgagatat
catggtgattccccaatcgtaagcaaacttgtggatgaggggcttatagatgcgatttca
tatcatcagattgagattttcgatgcagcaataatgtttgcaaggactgaaggtatagca
ccagctcctgaagcatcacatgcaataaaagctgctatcgatgaagctgtaaggtgcagg
aagaccggggaagagaaaacaattctgttcaatctgagtgggcatggacactttgatatg
tcctcctatgataggtatttctcaaaaaagctcagcgatgattga

DBGET integrated database retrieval system