KEGG   Methanosalsum zhilinae: Mzhil_1495Help
Entry
Mzhil_1495        CDS       T01541                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mzh  Methanosalsum zhilinae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mzhil_1495
Enzymes [BR:mzh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mzhil_1495
Exosome [BR:mzh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mzhil_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1611070..1612044
Genome map
AA seq 324 aa AA seqDB search
MFPQVRMRRLRSANIQRMVCETTLSTDDIIYPMFIDENISTPQKIPSMPGIYRLPPSQAA
SDAKEASDLGIPAVILFGIPEKKDEKGSSACGDDDVVQKAAREIKNELGKDMAIITDVCL
CEYTTHGHCGVVNYESEEVLNDPTLDILGQVAVSHAKAGADMVAPSGMMDGMIKAIRSSL
DSNNYSNIPIMSYAAKYSSTFYGPFRDAADSGYSFGDRSGYQMNPANSNEALREVELDIK
EGADIVMVKPALPYLDILYRIKDTFKIPTAAYNVSGEYSMLKAAAQNGWLDERSVMYESL
LSIKRAGADMIITYFAKDIARLLK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttccacaggtcagaatgagaaggcttagaagtgcaaatatacagagaatggtttgt
gagactacattaagtacggatgatataatttatcctatgtttattgatgaaaacatatcc
acaccacagaagataccatcaatgcctggtatttatagactcccgccaagccaagctgcc
agtgatgcaaaggaagcttcagatcttggaatacccgcagtcattcttttcgggatacct
gaaaaaaaagatgaaaagggatcatctgcatgtggagatgatgatgtggtccagaaagct
gccagggagatcaaaaatgaactgggaaaggatatggccataattaccgatgtttgcctt
tgcgaatataccacccacggacactgcggggttgttaattatgaatccgaggaggtcctg
aacgatccgacacttgatattctgggacaggttgcagtcagtcatgcaaaagcaggagct
gacatggttgcaccttctggtatgatggacgggatgatcaaagctatcagatcctccctt
gacagcaacaattattcgaatatacccataatgtcatatgctgcaaaatattcatctacc
ttttacggaccattccgggacgcagctgattcaggatactcctttggggacaggtcaggt
taccagatgaatcctgcaaattcaaatgaggcactgagggaagttgagctggatataaaa
gaaggggcggatattgttatggtaaagccggccctcccatatcttgatatcctttaccgg
ataaaggacacttttaaaataccaaccgctgcctacaatgtgagtggagagtattcaatg
ctcaaagctgctgcacagaacgggtggctggacgaaagatcagttatgtatgaatccctt
ctatcgatcaaaagggcaggagctgatatgatcattacctactttgcaaaggatattgca
cgtttacttaaataa

DBGET integrated database retrieval system