KEGG   Methanosalsum zhilinae: Mzhil_1580Help
Entry
Mzhil_1580        CDS       T01541                                 

Definition
RimK family alpha-L-glutamate ligase
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mzh  Methanosalsum zhilinae
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mzhil_1580
Enzymes [BR:mzh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     Mzhil_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1691852..1692775
Genome map
AA seq 307 aa AA seqDB search
MINMNEIAIIVTEPDDWTASSLMDSVKVYGGKPIAVNLSTVQCRIDRSSTCSAEEIDIFS
MDGIIVRDIGSGTLDEMAFRSDILVQAQEMGIPVINSPESIQKAANKYYSTHLFSKAGLP
HPPTRAVQDLDSAMNVVEEFRDCIIKPIFGYKGMDILRIRNGIIISQDGRTDRSLQIENV
MDRIIENRGVVYIQKFIENPGRDIRCFVVGGSVAGAILRNAQPGSWISNLSQGSIPEKYI
PSEHIKEMACRAAETIGTVFSGVDIIEGPNGPVILEINATPSGAGIYRAWGINVSDHIVR
YLFETIK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatatgaatgagattgcaatcatagtgactgagcctgatgactggactgcttcc
tccctgatggattctgtcaaggtttatggaggaaaaccgatagctgtaaacctttccact
gtacagtgcagaatagacagatccagtacctgtagtgctgaagaaattgatattttcagc
atggatggaattatcgtaagggatataggttcaggtacccttgatgaaatggcatttcga
tcagatatactggttcaggcccaggagatgggaatccctgtgatcaattctccagaatcc
atacagaaagctgccaacaaatattattcaacccacctattctcaaaggctggactcccc
catccacctacaagagcagtacaggaccttgacagtgcaatgaatgtggttgaagaattc
agagattgtataatcaagccgatttttggatataagggcatggatattttgagaataagg
aatggaataatcataagccaggatggaagaacggacaggtcattgcagatagaaaatgtc
atggacaggatcattgaaaatagaggtgtagtatatatacagaaattcatagagaaccct
ggccgtgatataagatgttttgttgttggcggaagtgtggcaggtgcgatcttgcgcaat
gcacagccaggatcatggatcagtaacctgagccagggaagcattccggaaaagtatata
ccttctgaacatatcaaagaaatggcctgtcgtgctgcagagaccattggaactgttttt
agcggggtagatatcattgaaggacctaacggaccggtaatactggaaataaatgccaca
ccttccggagctggcatatacagagcatggggtataaatgtatcagaccatatagtaaga
tatctttttgagaccatcaaataa

DBGET integrated database retrieval system