KEGG   Methanosalsum zhilinae: Mzhil_1640Help
Entry
Mzhil_1640        CDS       T01541                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mzh  Methanosalsum zhilinae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mzhil_1640
   00052 Galactose metabolism
    Mzhil_1640
   00500 Starch and sucrose metabolism
    Mzhil_1640
   00520 Amino sugar and nucleotide sugar metabolism
    Mzhil_1640
Enzymes [BR:mzh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mzhil_1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1754786..1755688
Genome map
AA seq 300 aa AA seqDB search
MNFNFKDGLILEVKKAVIPAAGLGTRFLPVTKSMPKEMLPIIDKPVIHYVVEEAISSGID
DILFITGRHKRSIEDYFDDSPELEMHLEHKGKNRMLEMVQDISSMADIHYIRQKEPRGLG
DAILTAEKHVGNEPFAVLLGDDIIANCKPCTEQLIEKFQYLGKSILAVEEVPPEKTSSYG
MIDGTPIDESLYSLNDIVEKPAPEDAPSNVGTIGRYIFTPEIFDCIKKTGKGFGGEIQLT
DAIKLLNQNQQVYAYRFTGNRYDTGDKLGYVKAIIDFALKNEKMKNQISEYLIEIFVHTK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttgaatttcaattttaaggatggattaattctggaagttaaaaaagcagtcataccggca
gcaggactcggtaccagattcctgccggtcacaaagtcaatgccaaaggaaatgcttcca
atcatcgacaagccggtgatacactacgtagttgaggaagccatttcctcaggaatcgat
gatatcttattcattaccggaagacacaaacgctcaatagaggactattttgatgactcc
cctgaacttgagatgcatcttgagcataagggcaagaacaggatgcttgagatggtgcag
gatatctcatcaatggcagatatacactacattagacagaaagagccaaggggacttgga
gatgcaatacttacagctgaaaagcatgtcgggaacgaaccctttgcagtactgcttgga
gatgatatcattgccaactgcaaaccatgtacagagcagctaattgaaaaattccagtac
cttggcaaatcaatacttgcagttgaagaggtgccacctgaaaaaaccagcagttacgga
atgatcgatggcacacccattgacgaatcactctattcactcaatgacattgtggaaaaa
ccggcacccgaagatgctccatccaatgtcggaacaatcggcagatatatctttacacca
gaaatttttgattgcatcaaaaaaacaggcaaaggattcgggggagaaatccagctaaca
gatgccatcaagctcctcaaccagaatcagcaggtctatgcatacagatttaccggcaac
agatatgacacaggggataagcttggatacgtgaaggccattattgactttgctttgaaa
aatgagaaaatgaaaaatcagataagtgaatatcttatagaaatatttgtacatactaaa
taa

DBGET integrated database retrieval system