KEGG   Methanosalsum zhilinae: Mzhil_1693Help
Entry
Mzhil_1693        CDS       T01541                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mzh  Methanosalsum zhilinae
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mzhil_1693
Enzymes [BR:mzh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mzhil_1693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1811489..1812046)
Genome map
AA seq 185 aa AA seqDB search
MWQEISKYGNKLVQQGLVESHFGNISIRDGERIFITARGYALDEITEDGVVEVDVNSPTD
RDLMSSTETIVHRAIYQQSRARAVIHAHCPFSVVESLLSDTGLIEPLDSEGKCFLKNIPV
IRGQMGSEELAHNAGMALSDHNAVIVHGHGTFATGSSLKEAYVITTQIEHSCRIRYWYDL
ARKYC
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggaaatatcaaagtacgggaataaacttgttcagcagggtctggttgaatcc
cacttcggaaatatcagtataagggatggcgagcgtatatttataactgcaagaggatac
gcccttgatgaaattacagaggatggtgttgtggaggttgacgtgaattctcccacagac
cgtgatctcatgtcttccacagagaccattgtacaccgggctatctatcagcagtcccgg
gcacgtgctgtgatccatgcgcactgtcccttttctgttgtagagtccctgctatctgat
acgggtctgatagagccactggacagtgaaggaaaatgttttctgaagaatattccggtg
ataaggggacagatgggatcagaggagcttgcacacaatgccggtatggcgctttcggat
cacaatgctgtaattgtacatgggcatggtacgtttgcaacaggcagcagtttaaaggaa
gcctatgtaataaccacacagatcgagcattcatgtcgtatcaggtactggtatgacctt
gcaaggaaatattgttaa

DBGET integrated database retrieval system