KEGG   Methanosalsum zhilinae: Mzhil_1733Help
Entry
Mzhil_1733        CDS       T01541                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mzh  Methanosalsum zhilinae
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Module
F420 biosynthesis
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mzh00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1850913..1851710
Genome map
AA seq 265 aa AA seqDB search
MAQVAVSKRGITLRIELFTVNDIPMIREGDDLAAIICNNTSLEDGDIVVIASTIVAKAEG
RIFSLENIVPGRRAIDIGHRCGRDPAFVQAVLDRSVECLVEAPFILVQLESGQICVNAGI
DDSNVEEGLFLDLPEDPDASARRIAADIKKMTGMRVSLVITDTNGRAFRIGQTGIAIGIA
NIEPVRDWIGESDLFGNRLQITQEAVADEVASAANLLMGEGSGGTPVVIMRGLNIHNTTG
SIQQIYRIEEEDIIKKGLKCLQKDS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggttgctgtcagtaaaagaggtatcacattgagaatcgagttgtttactgta
aatgacataccaatgatcagagaaggagatgaccttgctgctattatatgcaataatact
tcactggaagacggggatatagtagttattgcatccacaatagtagcaaaggctgaagga
agaatcttttcactggagaatatagttcctggcaggcgtgcaatagatattgggcacagg
tgtggcagagatcctgcatttgtacaggcagtacttgatagaagtgttgaatgtcttgtg
gaagctccttttatactggtccagcttgaaagtggacagatatgtgtaaatgcaggaatt
gacgattcaaatgttgaagagggattatttctggatcttcctgaagatcctgatgcaagt
gccaggcgtattgctgcagatatcaaaaaaatgaccggtatgagagtgtctcttgtgatc
acagatacaaatggaagagcattcaggatagggcagactggaatagccattggtattgca
aacattgaacctgtcagggactggataggagaaagcgaccttttcggaaacagacttcag
ataactcaggaagctgttgcagatgaggtcgcttctgctgcaaatctattgatgggagag
ggtagcggcggaactcctgtagtgataatgagaggattgaacatacacaatacgaccgga
tctatccagcaaatttaccgtatcgaagaggaagatattattaagaagggacttaagtgt
ctgcaaaaggattcctga

DBGET integrated database retrieval system