KEGG   Methanosalsum zhilinae: Mzhil_1738Help
Entry
Mzhil_1738        CDS       T01541                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mzh  Methanosalsum zhilinae
Brite
Enzymes [BR:mzh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mzhil_1738
Transfer RNA biogenesis [BR:mzh03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mzhil_1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1856173..1857816
Genome map
AA seq 547 aa AA seqDB search
MPENTHQKHLACRELLEMVLDGSISSTLELNAAKKRVSQKYKLPTLPSNPDITMAGNEAE
QKKAREILRRKPVRTISGVAVIAAMTSPAPCPHGACVPCPGGPDSRFNSPQSYMGQEPAA
MRAIHHNYDPYSSVTSRLTQLQEIGHDIHKAELIVMGGTFTSRSLDYQEWFTKRCLEAMN
DYYGKDWRDGVGSGNTLYITLETVQKANEVAAVRNTGITFETRPDWARKEHVDRMLKLGA
TKVEIGVQSIYNYVLTRINRGHTVEDTIEANRILRDSGLKVGFHMMPHLPGMSTERDLRS
FRTLFEDSRFMPDYLKIYPTLVTEGTKLYDMWKQGEYKPPDDVQSAQLLADIKECLPEWV
RLQRIQRDIPAHQIFAGNRKSNIRQLARNILDQRGAKCRCIRCREVGHRILQGSEPDPSN
IEMRVQKYQACGGTEHFITFEDTVQDLLVGFLRLRFPALPHRPELENAAVVRELHVYGSM
VPVGQKAGERDWQHRGYGTELLEHAESIAEEAGYNKLAIISGIGVRDYYRKLGYESDGPY
MSRELNH
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagaacacacaccagaaacatcttgcatgcagagaacttcttgaaatggtactt
gatggatccatctccagcacacttgagttaaatgctgcaaagaaaagggttagccaaaaa
tataaattacctacacttccgagtaatcctgatatcaccatggcaggaaatgaagccgaa
cagaaaaaagctcgggaaatacttagaagaaaaccagtgcgtaccatctccggtgtagca
gtaattgcagcaatgacctcacctgcgccctgtccacatggagcatgtgttccctgtcct
ggcggaccagattcacgatttaattcaccccagagctatatgggccaggagcctgctgcc
atgcgagcaatccaccacaattatgacccctattcctcagttacatccagactcacgcag
cttcaggagatcggacatgacatccataaggcagagcttatagtcatgggaggtaccttt
acctcacgttcactggattatcaggaatggttcacaaagcgctgtcttgaagcaatgaat
gattactatggtaaagattggagggatggtgtaggttccggcaacactttatatataaca
ttggaaactgtccagaaagcaaacgaggtggctgctgtaagaaatacaggcattaccttt
gaaaccagaccggactgggcaagaaaagaacatgtggacagaatgctaaaactgggtgcc
acaaaggttgagataggagttcagagcatctataactatgtacttaccagaattaaccgg
ggacatacagttgaagataccattgaagcaaacaggatactcagggacagcggactgaag
gtaggatttcatatgatgccacatctgcctggtatgagcactgaaagggatcttcgcagt
ttcagaacactttttgaagattcaagatttatgcccgattatctaaagatatatcccacc
cttgttactgaaggaacaaaactgtacgatatgtggaaacagggagaatacaaaccaccg
gatgatgtacagagtgcacagcttcttgcagatatcaaagaatgtcttccggaatgggtc
agattgcagcgtattcagagagatattccggcacatcagatatttgcaggtaaccggaaa
agcaatatccgccagctggccagaaacattctggaccagagaggagcaaaatgcagatgt
ataagatgcagggaagtgggacacagaatattacagggcagtgaacctgacccttcaaac
atagaaatgagagttcagaaataccaggcatgcggcggtactgaacatttcattacattt
gaagacacagtccaggatctcctggtaggatttctaagacttcgatttcctgcattaccc
cacagacctgaacttgaaaatgctgcagttgtcagagaacttcatgtatacggatcaatg
gtacctgttggccagaaggccggtgagagagactggcagcacagaggatacggaaccgaa
ctgctggaacatgcagaatcaatcgcagaggaggcaggctacaacaaactggccataatc
agtggtattggagtcagggattactatcgtaaacttggatatgaatctgatgggccatat
atgtccagagaactgaatcattga

DBGET integrated database retrieval system