KEGG   Methanosalsum zhilinae: Mzhil_1808Help
Entry
Mzhil_1808        CDS       T01541                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00330  Arginine and proline metabolism
mzh00332  Carbapenem biosynthesis
mzh01100  Metabolic pathways
mzh01130  Biosynthesis of antibiotics
mzh01230  Biosynthesis of amino acids
Module
mzh_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mzhil_1808
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Mzhil_1808
Enzymes [BR:mzh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mzhil_1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF4135
Motif
Other DBs
NCBI-ProteinID: AEH61643
UniProt: F7XQP4
Position
complement(1923333..1924460)
Genome map
AA seq 375 aa AA seqDB search
MTDRMKILNDVNKIVIKIGTSSITREDGGLNRDFMDRIAAQVSHLHKQNKQVIIVSSGSI
GIGIEMLKLGYRPREIPIRQAAAAVGQSILMQEWSSTFKKYDLDVAQILLSYESFSNRLT
YLNLRNSISTLLSYGVVPIINENDCTCVHEIEATFGDNDKLSAMVASKTEADLLIMLSDI
DGLYDKNPKRNPDAKLLDTVEKITPEIESFGGNPTSTKGVGGMRTKIEAARICNMAGCYM
IIANSSIDNVILRILDGENIGTLFLTNEDVHKNRIRWIILSKSSGKIIVDPGAKDAIESS
MSLLPSGVIDVIGTFERGDIIEIECDGYLFAKGITDYSSDELSKIKGVHTDKIADILGYK
NYNHVIKQENIGLIF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgacagataggatgaaaatacttaatgatgtcaataaaatcgtcataaagatagggaca
tcatcaataacccgtgaagatgggggtctaaaccgcgattttatggaccggattgcagcc
caggtatcccatctgcataaacagaacaagcaggtaataattgttagctccgggtccata
ggaatcggaattgagatgcttaagctgggatacagacccagggaaatacctatacgccag
gctgccgctgctgtaggtcaaagcattctaatgcaggagtggagcagtacatttaagaaa
tacgaccttgacgtagcacagatacttctatcatacgaatcattttcaaaccgtctcacc
tatctcaaccttaggaacagcatatcaacacttctcagctatggtgttgtccctataata
aatgaaaatgactgtacctgtgtacatgaaatagaagctacttttggagacaatgacaag
ctatctgctatggttgcaagcaaaacggaagccgacctgctcataatgctttcagacatt
gatggcctgtatgataaaaatccgaaaagaaaccctgatgcaaagctccttgataccgtt
gaaaagataacacctgaaatagagagctttggaggaaatcctaccagcactaaaggtgtt
ggaggtatgagaactaaaatagaagctgccaggatatgcaatatggccgggtgttacatg
ataattgcaaacagcagtatagacaatgtaattctaaggatcctggatggagaaaatatc
ggaacactgttcctgacaaatgaagatgtccataagaaccgtattcgatggataatcctt
tcaaaatcgtccggtaaaataattgtggatcccggtgcaaaggatgcaattgagagcagt
atgagtcttttgccatccggtgtgatagatgttatcggaacattcgagcgtggagacatt
atagaaatcgagtgtgatggatacctctttgcaaagggtattacagattacagttcagat
gaactgagcaaaataaaaggcgtacataccgataagattgctgatatactgggatacaag
aactacaaccatgttatcaagcaggagaacataggtctaatattttaa

DBGET integrated database retrieval system