KEGG   Methanosalsum zhilinae: Mzhil_1815Help
Entry
Mzhil_1815        CDS       T01541                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mzh  Methanosalsum zhilinae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mzhil_1815
   00030 Pentose phosphate pathway
    Mzhil_1815
   00051 Fructose and mannose metabolism
    Mzhil_1815
   00052 Galactose metabolism
    Mzhil_1815
   00500 Starch and sucrose metabolism
    Mzhil_1815
   00520 Amino sugar and nucleotide sugar metabolism
    Mzhil_1815
  Nucleotide metabolism
   00230 Purine metabolism
    Mzhil_1815
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mzhil_1815
Enzymes [BR:mzh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mzhil_1815
    5.4.2.8  phosphomannomutase
     Mzhil_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1930100..1931440)
Genome map
AA seq 446 aa AA seqDB search
MTLFGTNGVRGIANEFITPQLVMDIAKSLGTYLGPDKRVVIGRDTRISGQMLESAAIAGA
LSSGLFVIDVGMAPIPAIQYYTRDHGDAGIAITASHNPREYNGIKLIAGDGSEFSRKGEN
EIEKIYYSREYKAATWDCTGEIITDNSVNDYYIRGIMNAVDTEKIRSRKFRVAVDTGCGA
GSLTLPFLLRKLGCEVITINSQIDGTFPWRNPEPTIESLGELKEVIQYSGADMGVAQDGD
ADRAVFFDEKGNFINEEVLLATVAKYILAQKKGPIVTPVSSSQRMADVAKDAGVEIIWTA
VGSINVARKMMETSAVFGGEGNGGFIFPEHQYCRDGGMACAKILEMMADGEKLSYITEGV
PVYFNSKTKVYCDNLNKTMEAAKSEVLQSEEKIDTTDGIKIWYEDGWLLIRPSGTEPLIR
IFAESKTMTRAEELMKFGKEMVEKYR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgacattgtttggaacaaacggagtaaggggaattgccaatgagttcattacgccacag
cttgtaatggatattgcaaaaagtcttggtacatatctgggaccagataaaagagttgtg
attggtagagatacacgaatatccggtcagatgcttgaatctgcagccattgccggggct
ctttcgtccggcctctttgtgattgatgttggaatggcaccaataccagccatccagtac
tataccagagaccatggagatgcagggattgccatcaccgcctctcacaatccaagagaa
tacaatgggattaaattaatagcaggagatggcagtgaattttcccgcaaaggagaaaat
gaaattgaaaagatatactattccagagaatacaaagctgccacctgggactgcacagga
gaaattattacagacaattcagtaaatgattattatatcagaggaataatgaatgcagtt
gatactgaaaaaatacgttcaagaaaattcagggtcgctgttgatacaggatgtggtgcc
ggttcccttaccttacctttccttttgagaaaacttggctgcgaggtgataaccatcaat
tcccagatagacggaaccttcccctggcgcaacccggagcctacaatcgaatcactgggt
gaactgaaggaagtgatacagtacagtggagctgatatgggagttgcacaggatggagat
gctgacagggctgtgttctttgatgagaaggggaattttataaatgaagaggttctgctt
gccacggtagcaaaatatattctggcccagaaaaaaggacctatcgtaactccggtcagt
tcatcacagagaatggcagatgttgcaaaggatgcaggggtcgagataatatggacagct
gttggatccatcaatgtagccagaaaaatgatggaaacatctgcggtctttggaggagag
ggaaatggtggattcatcttccctgaacaccagtattgtcgcgatggggggatggcatgt
gccaagatacttgaaatgatggcagatggtgaaaaattatcatatatcacagaaggtgta
cctgtctatttcaactcaaagacaaaggtctactgtgataatttgaataaaacaatggaa
gcagcaaaatcagaagttctgcaatctgaagaaaagatagataccactgatggaatcaag
atatggtatgaagacggatggcttctgatcagaccatcaggaacagaaccccttatcaga
atatttgcagaatcaaagactatgacaagagcagaagaattgatgaagtttggaaaagaa
atggtggagaagtacaggtga

DBGET integrated database retrieval system