KEGG   Methanosalsum zhilinae: Mzhil_1895Help
Entry
Mzhil_1895        CDS       T01541                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mzh  Methanosalsum zhilinae
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mzh00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2004084..2004962
Genome map
AA seq 292 aa AA seqDB search
MFYKPIMMDALSDYESSTYVIFGVPFDATSSYRSGSRWAPDAMRKASLNFESYNHFYKID
LQDLAIHDSGNFEISASIDETLHDLLVTVRSVVSDNKIPIMLGGEHSMSLPCIKACAENA
GNDFGVLVLDAHLDLRDEYAGVKYNHACVSRHILEEVTENYVTVGVRSGAGEEWDLARDR
NICHYTPEDVARKGIDGVADEIMDYLDCSRIYISLDMDVFDPAYAPGLGTPEPFGMNPWD
VRKLIHRFAPMSIGFDIVEIAPEYDSGQAAILGAKIMREFIAASASKNKKIQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgttctataaaccaatcatgatggatgcgctttctgattacgagtcatccacatacgtt
atttttggagtgccttttgatgcaacctcatcatatagaagtgggagccgctgggcccct
gatgccatgagaaaggcatctcttaactttgaaagttataaccatttctacaaaattgac
ctgcaggatctggccatccatgattcaggtaattttgagatatcagcatcaattgacgaa
acacttcatgatctgctggtcacagtcaggtccgttgtatcagacaataaaatacctatc
atgcttggaggagagcattcaatgagcctgccatgcatcaaagcctgtgcagaaaatgca
gggaatgattttggagtacttgtactggacgcacatctggatctaagagatgagtatgca
ggagttaagtacaatcatgcatgcgtatcaaggcacatactggaagaggttactgaaaat
tacgtaactgtaggtgtcaggagcggtgccggagaggaatgggatctggcacgggatagg
aacatatgccattacacccctgaagatgtagcaaggaagggtattgatggggttgcagat
gagattatggactatctggactgcagcaggatatatatatctcttgatatggacgtattt
gacccggcgtatgcccctggactgggtacacccgaaccttttggtatgaatccatgggat
gtccgaaaattgatacacaggtttgcaccaatgtcaataggttttgatatagttgaaata
gcacctgagtatgacagtggccaggctgccatacttggtgccaagataatgcgagagttc
attgcagcttctgcgtccaaaaataaaaaaatccaatag

DBGET integrated database retrieval system