KEGG   Methanosalsum zhilinae: Mzhil_2014Help
Entry
Mzhil_2014        CDS       T01541                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00010  Glycolysis / Gluconeogenesis
mzh00020  Citrate cycle (TCA cycle)
mzh00620  Pyruvate metabolism
mzh00640  Propanoate metabolism
mzh00650  Butanoate metabolism
mzh00680  Methane metabolism
mzh00720  Carbon fixation pathways in prokaryotes
mzh01100  Metabolic pathways
mzh01120  Microbial metabolism in diverse environments
mzh01130  Biosynthesis of antibiotics
mzh01200  Carbon metabolism
Module
mzh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mzhil_2014
   00020 Citrate cycle (TCA cycle)
    Mzhil_2014
   00620 Pyruvate metabolism
    Mzhil_2014
   00640 Propanoate metabolism
    Mzhil_2014
   00650 Butanoate metabolism
    Mzhil_2014
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mzhil_2014
   00680 Methane metabolism
    Mzhil_2014
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mzhil_2014
Enzymes [BR:mzh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mzhil_2014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_9 Fer4_7 Fer4_6 Fer4_2 Fer4_10 Fer4_4 Fer4_16 Fer4_17 Fer4_8 Fer4_13 Fer4_15 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AEH61847
UniProt: F7XL35
Position
2124745..2125005
Genome map
AA seq 86 aa AA seqDB search
MSITPGGVCQPGTTRENKTGGWRNFRPIYHYDKCIKCKLCELLCPDMSVILRDDGFYDFD
YDYCKGCGLCANECPVDAIEMILEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcacaccaggaggagtatgccagccaggaaccactcgagaaaacaagacaggc
ggatggagaaactttagacctatctatcattacgataaatgtataaaatgtaaactctgt
gaactgctgtgtcctgatatgtcggttattctgcgagatgatggattctatgattttgat
tatgattactgtaagggatgtggactctgcgccaatgaatgtcctgtagatgccattgaa
atgattctggaggaaaaataa

DBGET integrated database retrieval system