KEGG   Nocardiopsis alba: B005_0055Help
Entry
B005_0055         CDS       T02218                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
nal  Nocardiopsis alba
Pathway
nal00230  Purine metabolism
nal01100  Metabolic pathways
Module
nal_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    B005_0055 (gmk)
Enzymes [BR:nal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     B005_0055 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 RsgA_GTPase AAA_29 AAA_22 AAA_25 NTPase_1 AAA_28 AAA_5 AAA_30 CbiA ABC_tran ATP_bind_2 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFR08277
UniProt: J7LCQ0
Position
complement(58977..59522)
Genome map
AA seq 181 aa AA seqDB search
MTVLSGPSGVGKSTVVAHLREVDPDVWLSVSVTTRAPRPGEREGVQYHFVTDEEFDRLIE
QGELLEWACFAGNRYGTPRGPVQERLDSGVPVLLEIELQGARQVRESMSDALHVFLAPPS
WEELVRRLTGRGTESDEVIQRRLEAAKVELAAEKEFDTTLVNTSVQEVCDELLALMTAPK
V
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgtcctgtccggcccctccggggtcggcaagagcacggtcgtcgcccacctgcgc
gaggtcgaccccgacgtgtggctttcggtgtcggtgaccacccgcgccccccgccccggc
gagcgggagggtgttcaataccacttcgtcaccgacgaggagttcgaccgtctgatcgaa
cagggtgaactcctagagtgggcctgcttcgcgggcaaccgctacggcactccccgcggc
cccgtccaggaacgcctggactccggggtccccgtcctgttggagatcgaactccagggc
gcccgccaggtccgggagtccatgtccgacgctctgcacgtcttcctcgccccgccctcc
tgggaggagctggtccgcaggctcaccggccggggcaccgagtccgacgaggtcatccag
cgcagactggaggcggccaaggtcgagctggccgcggagaaggaattcgacacgaccctg
gtcaatacgtccgtacaggaagtgtgcgacgagctgctagcgttgatgaccgcgcccaag
gtgtga

DBGET integrated database retrieval system