KEGG   Nocardiopsis alba: B005_0080Help
Entry
B005_0080         CDS       T02218                                 

Gene name
pfkA1
Definition
(GenBank) 6-phosphofructokinase 1
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
nal  Nocardiopsis alba
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B005_0080 (pfkA1)
   00030 Pentose phosphate pathway
    B005_0080 (pfkA1)
   00051 Fructose and mannose metabolism
    B005_0080 (pfkA1)
   00052 Galactose metabolism
    B005_0080 (pfkA1)
  Energy metabolism
   00680 Methane metabolism
    B005_0080 (pfkA1)
Enzymes [BR:nal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B005_0080 (pfkA1)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     B005_0080 (pfkA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
85724..86749
Genome map
AA seq 341 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVVRKGIKDYGYEFIGFRDGWRGPLEGDTMPLDVSAVRGI
LPRGGTILGSSRTNLMKIEGGVERVKDNMAGLGVDALVAIGGEDTLGVARQLHDRGVNVV
GVPKTIDNDLNATDYTFGFDTAVNIAVEAIDRLHTTAESHHRALVVEVMGRHAGWIALHS
GMAAGANVILIPERPFDIDEVVAHVESRFRTQYAPIIVVAEGAHPKEGQMELQTGEKDSF
GHVRLGGIGQNLADEIERRTGKESRSVVLGHVQRGGTPSAFDRVLATRLGVHAIEAVHDK
AFGRMVGLQGTDIVRVDLAEATDTLKTVPAERYQEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcggtgtgctgaccggtggcggagactgccccggtctgaacgcggtcatccgc
gccgtggtccgtaagggcatcaaggactacggctacgagttcatcggcttccgggacggc
tggcgtgggcccctggagggcgacaccatgccgctggacgtgtcggccgtacgcggcatc
ctcccccgcggaggaaccatcctgggctcctcccgcaccaacctgatgaagatcgagggc
ggtgtcgagcgggtcaaggacaacatggccggcctgggcgtggacgccctggtcgccatc
ggcggcgaggacaccctcggtgtggcccggcagctgcacgaccgcggcgtcaacgtggtg
ggcgtccccaagaccatcgacaacgacctcaacgccacggactacacgttcgggttcgac
acggccgtcaacatcgcggtggaggcgatcgaccgcctgcacaccacggcggagtcccac
caccgcgccctggtcgtcgaggtcatgggccggcacgccggctggatcgccctgcactcg
ggtatggccgcgggcgccaacgtcatcctcatccccgagcgccccttcgacatcgacgag
gtcgtcgcgcacgtcgagagccgtttccggacgcagtacgcccccatcatcgtggtcgcc
gagggagcccaccccaaggagggccagatggagctccagaccggcgagaaggactccttc
ggccacgtccgtctgggcggcatcggccagaacctggccgacgagatcgagcgccgcacc
ggcaaggagtcccgctcggtcgtgctcggccacgtccagcgcggcggcaccccctccgcc
ttcgaccgggtgctcgccacccgcctgggcgtgcacgccatcgaggccgtgcacgacaag
gccttcggtcggatggtcggccttcagggcaccgacatcgtccgtgtcgacctggccgag
gccaccgacaccctcaagacggtccccgccgagcgttaccaggaggccgaggtcttcttc
ggctga

DBGET integrated database retrieval system