KEGG   Nocardiopsis alba: B005_0080Help
Entry
B005_0080         CDS       T02218                                 

Gene name
pfkA1
Definition
6-phosphofructokinase 1 (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nal  Nocardiopsis alba
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B005_0080 (pfkA1)
   01230 Biosynthesis of amino acids
    B005_0080 (pfkA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B005_0080 (pfkA1)
   00030 Pentose phosphate pathway
    B005_0080 (pfkA1)
   00051 Fructose and mannose metabolism
    B005_0080 (pfkA1)
   00052 Galactose metabolism
    B005_0080 (pfkA1)
  Energy metabolism
   00680 Methane metabolism
    B005_0080 (pfkA1)
Enzymes [BR:nal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B005_0080 (pfkA1)
Protein phosphatases and associated proteins [BR:nal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B005_0080 (pfkA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
85724..86749
Genome map
AA seq 341 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVVRKGIKDYGYEFIGFRDGWRGPLEGDTMPLDVSAVRGI
LPRGGTILGSSRTNLMKIEGGVERVKDNMAGLGVDALVAIGGEDTLGVARQLHDRGVNVV
GVPKTIDNDLNATDYTFGFDTAVNIAVEAIDRLHTTAESHHRALVVEVMGRHAGWIALHS
GMAAGANVILIPERPFDIDEVVAHVESRFRTQYAPIIVVAEGAHPKEGQMELQTGEKDSF
GHVRLGGIGQNLADEIERRTGKESRSVVLGHVQRGGTPSAFDRVLATRLGVHAIEAVHDK
AFGRMVGLQGTDIVRVDLAEATDTLKTVPAERYQEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcggtgtgctgaccggtggcggagactgccccggtctgaacgcggtcatccgc
gccgtggtccgtaagggcatcaaggactacggctacgagttcatcggcttccgggacggc
tggcgtgggcccctggagggcgacaccatgccgctggacgtgtcggccgtacgcggcatc
ctcccccgcggaggaaccatcctgggctcctcccgcaccaacctgatgaagatcgagggc
ggtgtcgagcgggtcaaggacaacatggccggcctgggcgtggacgccctggtcgccatc
ggcggcgaggacaccctcggtgtggcccggcagctgcacgaccgcggcgtcaacgtggtg
ggcgtccccaagaccatcgacaacgacctcaacgccacggactacacgttcgggttcgac
acggccgtcaacatcgcggtggaggcgatcgaccgcctgcacaccacggcggagtcccac
caccgcgccctggtcgtcgaggtcatgggccggcacgccggctggatcgccctgcactcg
ggtatggccgcgggcgccaacgtcatcctcatccccgagcgccccttcgacatcgacgag
gtcgtcgcgcacgtcgagagccgtttccggacgcagtacgcccccatcatcgtggtcgcc
gagggagcccaccccaaggagggccagatggagctccagaccggcgagaaggactccttc
ggccacgtccgtctgggcggcatcggccagaacctggccgacgagatcgagcgccgcacc
ggcaaggagtcccgctcggtcgtgctcggccacgtccagcgcggcggcaccccctccgcc
ttcgaccgggtgctcgccacccgcctgggcgtgcacgccatcgaggccgtgcacgacaag
gccttcggtcggatggtcggccttcagggcaccgacatcgtccgtgtcgacctggccgag
gccaccgacaccctcaagacggtccccgccgagcgttaccaggaggccgaggtcttcttc
ggctga

DBGET integrated database retrieval system