KEGG   Nocardiopsis alba: B005_0087Help
Entry
B005_0087         CDS       T02218                                 

Definition
thermostable monoacylglycerol lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
nal  Nocardiopsis alba
Brite
Enzymes [BR:nal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     B005_0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(92465..93262)
Genome map
AA seq 265 aa AA seqDB search
MRPTSAIPLIPGAEPFSHSGSSTGVLLCHGFTGSPHSMRPWAEHLAEAGLTVELPRLPGH
GTTWQDMAATGTDDWYAAVEGTLLDLAERCDEVFVMGLSMGGALTLRLLQDHPDLVSGVV
LVNPSLAMEDRRLAFIEPFRSVAARLLPSTPGISSDVSLERVSEGGYDRIPTASAATLPK
LWRTVQEGMSGLRGPILAYRSTQDHVVGPNSLRILARRAVDARLTIHLLHDSYHVATLDH
DAATIFEGSLAFVREHSRSEEGADR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgagaccgaccagtgccatccccctgatcccgggggccgagcccttcagccactccggt
tcctcgaccggtgtgctgctctgtcacggtttcaccggatctccccactccatgcgtcct
tgggcggagcacctggccgaggccggactcaccgtcgagctcccccggttgcccggtcac
ggcaccacctggcaggacatggcggccacgggcaccgacgactggtacgcggccgtcgag
gggacgctgctggacctcgccgaacgctgcgacgaggtgttcgtcatggggttgtcgatg
ggaggggccctcaccctccgactgctccaggatcaccccgacctcgtctccggtgtcgtt
ctggtcaacccctccctggcgatggaggaccgcaggctcgcgttcatcgaaccgttccgt
tccgtggcggcccgtctgctgccctccacccccggtatctccagcgacgtgtcgttggag
agggtctccgagggagggtacgaccggatccccaccgcctcggccgcgacactcccgaag
ctgtggcgcacggttcaggagggcatgtccggtttgcgggggccgattctggcgtataga
agcactcaggaccacgtcgtcggaccgaacagtctgcgtatcctcgccaggagagcggtc
gacgcccggctgacgatccacctgcttcacgacagctaccacgtggcgacactcgaccac
gacgccgccacgatcttcgaaggcagcctcgccttcgtgcgagagcacagtagaagcgag
gaaggagccgaccgatga

DBGET integrated database retrieval system