KEGG   Nocardiopsis alba: B005_0089Help
Entry
B005_0089         CDS       T02218                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nal  Nocardiopsis alba
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B005_0089
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B005_0089
   00052 Galactose metabolism
    B005_0089
   00500 Starch and sucrose metabolism
    B005_0089
   00520 Amino sugar and nucleotide sugar metabolism
    B005_0089
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B005_0089
   00524 Butirosin and neomycin biosynthesis
    B005_0089
Enzymes [BR:nal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     B005_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(94595..95542)
Genome map
AA seq 315 aa AA seqDB search
MLTIGVDIGGTKVAAGVVDPDGQILDKVKYPTPSGDPGQLAEVVAKAVEELRGRRPDDTI
EAVGVGVAGFVDEDRATVQVAVNLGLRDEPLKERVRRRIELPVVIENDANAAAWAEARFG
AGRGSDHIVCVTLGTGIGGGLVLGGRLHRGRYGVAAEVGHYRVVQNGRRCACGDQGCWEQ
YASGTALVAEGRDLARTDPVRAARMLELAGGDADRVDGECMTRAALEGDTGALGCFERVG
EWVGIGLADLAAILDPECFVLGGGVSDTGDIILGPAREAFERNLSGRPNRRPAQVRLAEL
GGEAGIVGAADLARR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccatcggcgtagacatcggtggaaccaaggtcgccgccggtgtcgtcgacccc
gacggacagatcctggacaaggtcaagtacccgaccccgtccggcgaccccggccaactc
gccgaggtcgtggccaaggccgtggaggaactgcgcggccgtaggcccgacgacacgatc
gaggccgtgggcgtgggcgtggccggcttcgtcgacgaggaccgggccaccgtccaggtc
gccgtcaacctggggctgcgcgacgagccgctcaaggaacgcgtccggcgacggatcgaa
ctgcccgtggtcatcgagaacgacgccaacgccgccgcctgggccgaggcccgcttcggc
gcggggcgcggcagcgaccacatcgtctgcgtcaccctgggcaccggcatcgggggcggc
ctggtcctcggcggtcggctccaccgcggccgctacggggtggccgccgaggtcggccac
taccgggtggtgcagaacggccgccgatgcgcctgcggggaccagggctgctgggagcag
tacgcgagcggcaccgccctggtcgccgagggacgggacctggcccgcaccgaccccgta
cgggcggcccgcatgctggagctcgccggtggggacgcggaccgggtcgacggcgagtgc
atgacccgcgcggccctggagggcgacaccggcgccctgggctgcttcgaacgcgtgggg
gagtgggtcgggatcggcctggccgacctcgcggccatcctcgaccccgagtgcttcgtc
ctgggcggaggggtctccgacaccggggacatcatcctcggcccggcgcgcgaggccttc
gaacgcaacctctcggggcgtccgaaccgccgtccggcccaggtccgcctggccgagctc
ggcggcgaggcgggcatcgtcggggccgcggacctggcccgacgctga

DBGET integrated database retrieval system