KEGG   Nocardiopsis alba: B005_0130Help
Entry
B005_0130         CDS       T02218                                 

Definition
glycine cleavage H-family protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nal  Nocardiopsis alba
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nal01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nal00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:nal00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
133431..134549
Genome map
AA seq 372 aa AA seqDB search
MPTSVSMPALGESVTEGTVTQWLKNVGDTVEVDEPLLEVSTDKVDTEIPSPVSGVLTKIL
VDEDDTVEIGAEIAIIGGEGESADAPAEPEPAAAPEPEAEPEPEPAPAAEEPAPTPEPAP
ASPAATGTGTPVDMPALGESVTEGTVTQWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPVA
GVLTEILVAEDETVEIGARIALIGGSASAPAAPAESAPAPAAPKPTSAPAPATPAPAAQE
QDSEGGPSVDVETLSGTGRASGTDAVTEAYVTPLVRKLAGEHRVDLSRVTGTGVGGRIRK
QDVLKAAEARSSAAAAPRRTGSDREADASASVHRRPHGGVAARLRHDHPGHRGRRHQDRA
PAHPGRGRLHQA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgccgacttccgtttccatgcccgccctgggtgagagcgtcaccgaggggaccgtcacc
cagtggctgaagaacgtgggcgacaccgtcgaggtagacgagccgctccttgaggtctcc
accgacaaggtggacaccgagatcccgtccccggtgtccggtgtactcaccaagatcctc
gtcgacgaggacgacaccgtggagatcggcgcggagatcgcgatcatcggtggcgagggc
gagtccgccgacgcgccggccgagcccgagcccgccgccgctcccgagccggaggccgag
cccgaacccgagcccgccccggccgccgaggagcccgcccccacgcccgagcccgctccc
gcgagccctgcggccacgggcaccggtactccggtggacatgcccgccctgggtgagagc
gtcaccgaggggaccgtcacccagtggctcaagagcgtgggcgacaccgtcgaggtggac
gagccgctgctcgaggtctccaccgacaaggtggacaccgagatcccgtccccggtcgcc
ggtgtgctcaccgagatcctggtggccgaggacgagacggtggagatcggcgcccgtatc
gccctgatcggcggctccgcctccgctcccgccgctcccgccgagtccgctcccgctccg
gccgccccgaagcccacgagcgcccccgccccggccacgcctgctcccgccgcacaggag
caggactccgaggggggcccgtccgtggacgtcgagacgctgagcgggaccggtcgcgcc
tccggcaccgacgccgtgaccgaggcctacgtgaccccgctggtccgcaagctcgccggc
gagcaccgtgtcgacctgagccgtgtcaccggcaccggcgtgggcggtcgcatccgcaag
caggacgtgctcaaggccgccgaggcccggagctcggccgccgccgctccgcgccggacc
ggctcggaccgagaagctgacgcgtctgcgtctgtccatcgccgaccgcatggtggagtc
gctgcacgtctccgccacgaccacccaggtcatcgaggtcgacgtcaccaagatcgcgcg
cctgcgcacccaggccgcggccgacttcaccaagcgtga

DBGET integrated database retrieval system