KEGG   Nocardiopsis alba: B005_0131Help
Entry
B005_0131         CDS       T02218                                 

Definition
2-oxoacid dehydrogenases acyltransferase family protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nal  Nocardiopsis alba
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B005_0131
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B005_0131
  Amino acid metabolism
   00310 Lysine degradation
    B005_0131
Enzymes [BR:nal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B005_0131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
134554..135114
Genome map
AA seq 186 aa AA seqDB search
MDLDFFPFFALAAVEALKAHPEVNAVIDSQAQTVTYHDIENLAISVDTERGLLAPVVKDA
GSLNLGGLARTITDLTERAHTAVLSPDELVGGTFTITDTGHTGALFGTPIINQPQVAILG
AGAVVKRPVVVEDSAMGGEVIAVRSMVYLSMAHDHRLIDSADAGRFLQTVKARLEEGAFE
SELGLA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtggacctggacttcttcccgttcttcgcgctggccgcggtggaggccctcaaggcccac
cccgaggtcaacgcggtgatcgacagccaggcccagacggtgacctaccacgacatcgag
aacctggcgatctcggtggacaccgagcgcggtctgctcgccccggtcgtcaaggacgcc
ggttcgctgaacctgggcggtctggcccggaccatcaccgacctgaccgagcgggcccac
accgccgttctgagcccggacgagctggtcggcggtaccttcaccatcaccgacaccggc
cacaccggcgccctgttcggcaccccgatcatcaaccagccccaggtcgcgatcctgggc
gcgggcgcggtcgtcaagcgcccggtcgtggtcgaggactccgccatgggcggcgaggtc
atcgcggtccggtcgatggtctacctgtcgatggcccacgaccaccgtctgatcgacagc
gccgacgccggccgcttcctccagacggtcaaggcccgtctggaggagggcgccttcgag
agcgagctcggtctggcctga

DBGET integrated database retrieval system