KEGG   Nocardiopsis alba: B005_0188Help
Entry
B005_0188         CDS       T02218                                 

Gene name
pdp
Definition
pyrimidine-nucleoside phosphorylase family protein (EC:2.4.2.2)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
nal  Nocardiopsis alba
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    B005_0188 (pdp)
Enzymes [BR:nal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     B005_0188 (pdp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(194907..196196)
Genome map
AA seq 429 aa AA seqDB search
MDVIEIIRAKRDGGTLTPEQIDWVIGAYTRGEIAEEQMAALAMAIFLQGMDRAEVSRWTE
AMLDSGERLDFSDLARPTTDKHSTGGVGDKITLPLTPTVAACGAAVPQLSGRGLGHTGGT
LDKLEAIPGWKASLSTEEMRRVLTTTGGVICAAGSGLAPADRRLYALRDVTGTVESIPLI
SASIMSKKLAEGTGSLVLDVKVGSGAFMKDLASARELARTMVDIGNDHGVRTVALLTDME
SPLGRQVGNALEVAEAVEVLSGGGPADVVELTVALAREMLLAAGLTPGEGGTKDPAEALR
DGSALASWKELVREQGGDPDAPLPVAAERRVVLAPAGGVVTRLDAYQVGLAAWRLGAGRA
RKEDAVSFGAGVTLHAKPGEEVKAGEPLFTLHTDEPERFDRAAEALEGAFDIGAGDEWKA
APLVIDRIA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcatcgagatcatccgcgccaagcgcgacggggggaccctcacccccgagcag
atcgactgggtgatcggggcctacacccgtggcgagatcgccgaggaacagatggcggcg
ctggccatggcgatcttcctccaggggatggaccgcgccgaggtgagccgatggacggag
gcgatgctggactcgggcgagcggctggacttctccgacctggcccggcccaccaccgac
aagcactccaccggaggggtcggcgacaagatcaccctgccgctcacccccaccgtggcg
gcctgcggcgcggccgtgccccagctctccggtcgcgggctgggccacaccggcggcacc
ctcgacaagctggaggccatccccggctggaaggcgtcgctgagcaccgaggagatgcgc
cgggtgctcaccaccacgggcggggtgatctgcgcggccggttccgggctggccccggcg
gaccgcaggctctacgccctgcgcgacgtcaccggcaccgtcgagtcgatcccgctcatc
tccgcctccatcatgagcaagaagctcgccgagggcaccggttcgctggtgctggacgtc
aaggtgggctcgggggcgttcatgaaggacctcgcctccgcccgcgaactggcccgcacc
atggtggacatcggcaacgaccacggggtgcgcaccgtcgccctgctcaccgacatggag
agcccgctggggcgtcaggtcggcaacgccctggaggtcgccgaggccgtcgaggtcctc
tccggaggcgggcccgccgacgtggtcgagctgaccgtggccctggcccgcgagatgctc
ctggccgccggtctgaccccgggcgagggcggcaccaaggacccggccgaggcgctgcgc
gacggcagtgcgctggcgtcctggaaggagctcgtgcgcgagcagggcggcgacccggac
gcgccgctgcccgtggccgccgagcgtcgcgtggtcctcgccccggccggtggcgtggtc
acccgcctggacgcctaccaggtgggcctggccgcctggaggctcggcgccgggcgagcg
cgcaaggaggacgcggtgtccttcggcgcgggcgtgaccctgcacgccaagccgggcgag
gaggtcaaggcgggcgagccgctgttcaccctgcacaccgacgagccggagcgcttcgac
cgggccgccgaggccctggagggcgcgttcgacatcggagccggcgacgagtggaaggcc
gccccgctggtcatcgaccgcatcgcctga

DBGET integrated database retrieval system