KEGG   Nocardiopsis alba: B005_0574Help
Entry
B005_0574         CDS       T02218                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
Organism
nal  Nocardiopsis alba
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C AlaDh_PNT_C FAD_oxidored HI0933_like Pyr_redox_2 FAD_binding_3 Pyr_redox DAO TrkA_N
Motif
Other DBs
NCBI-ProteinID: AFR08362
UniProt: J7LCX4
Position
complement(594151..595299)
Genome map
AA seq 382 aa AA seqDB search
MKALVYNGSRDVSVKEVPDARIERPTDVLVRITATNICGSDLHMYEGRTDLEPGKVLGHE
NLGVVAEIGSGVERVKVGDHVCLPFNIGCGFCRNCETGMPSYCLTANPDPEMAGAAYGFA
GMGPFSGGQAEYLRVPFGDFNCLRLPEDAQEKEDDYVMVADIFPTGWHATRLAGLKPGES
CVVYGAGPVGLMAAYSALLQGASQVMVVDRHPDRLRLVEQMGAIAVDDSKGDPVEQILNL
TDGRRADCGCECVGYQAHDHLGVEHPEMTMNNLVKSVKFTGGIGVVGIFLPSDPGAPDEM
ARNGRLPFEMGTFWFQGQKIGTGQAPVKAYNRQLRDMIHRDRAKPSFIVSHDLPLQRAPE
AYERFDNREDGWTKVVLKPSLV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcccttgtgtacaacggatcccgcgatgtctccgtcaaggaggtcccggacgcc
cggatcgagcgtcccaccgacgtgctcgtgcgcatcaccgcgaccaacatctgcggctcc
gacctgcacatgtacgaaggacgcaccgacctggagcccggcaaggtgctcgggcacgag
aacctcggcgtggtcgccgaaatcggcagcggcgtcgagcgcgtcaaggtcggcgaccac
gtgtgtctgccgttcaacatcggctgcggtttctgccgtaactgcgagaccggcatgccc
tcctactgcctgacggccaaccccgacccggagatggcgggggccgcctacggcttcgcc
ggcatgggtcctttctctggcgggcaggccgagtacctgcgcgtgccgttcggtgacttc
aactgcctgcggctgcccgaggacgcgcaggagaaggaggacgactacgtgatggtcgcc
gacatcttccccaccggctggcacgccacccgcctggccgggctcaaaccgggggagtcc
tgcgtcgtctacggcgcgggtccggtcggactgatggcggcctactccgcgctgctccag
ggggcgtcccaggtgatggtggtcgaccgccaccccgaccggctgcgcctggtcgagcaa
atgggggcgatcgccgtcgacgactccaagggcgacccggtcgagcagatcctcaacctc
accgacggccgccgcgcggactgcggctgtgagtgcgtcggttaccaggcccacgaccat
ctcggtgtcgagcaccccgagatgaccatgaacaacctggtgaagtcggtgaagttcacc
ggcggtatcggtgtcgtgggcatcttcctgccctccgatcccggagcgccggacgagatg
gcccgcaacggtcggctccccttcgagatggggacgttctggttccaggggcagaagatc
ggtaccggacaggcgccggtgaaggcctacaaccggcagctgcgggacatgatccaccgg
gaccgggcgaagccgtcctttatcgtgtcccacgacctgccgctgcagagggcaccggag
gcctacgagcgcttcgacaaccgcgaggacggctggaccaaggtggtgctcaagcccagc
ctggtgtga

DBGET integrated database retrieval system