KEGG   Nocardiopsis alba: B005_0574Help
Entry
B005_0574         CDS       T02218                                 

Definition
(RefSeq) zinc-binding dehydrogenase family protein
Organism
nal  Nocardiopsis alba
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(594151..595299)
Genome map
AA seq 382 aa AA seqDB search
MKALVYNGSRDVSVKEVPDARIERPTDVLVRITATNICGSDLHMYEGRTDLEPGKVLGHE
NLGVVAEIGSGVERVKVGDHVCLPFNIGCGFCRNCETGMPSYCLTANPDPEMAGAAYGFA
GMGPFSGGQAEYLRVPFGDFNCLRLPEDAQEKEDDYVMVADIFPTGWHATRLAGLKPGES
CVVYGAGPVGLMAAYSALLQGASQVMVVDRHPDRLRLVEQMGAIAVDDSKGDPVEQILNL
TDGRRADCGCECVGYQAHDHLGVEHPEMTMNNLVKSVKFTGGIGVVGIFLPSDPGAPDEM
ARNGRLPFEMGTFWFQGQKIGTGQAPVKAYNRQLRDMIHRDRAKPSFIVSHDLPLQRAPE
AYERFDNREDGWTKVVLKPSLV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcccttgtgtacaacggatcccgcgatgtctccgtcaaggaggtcccggacgcc
cggatcgagcgtcccaccgacgtgctcgtgcgcatcaccgcgaccaacatctgcggctcc
gacctgcacatgtacgaaggacgcaccgacctggagcccggcaaggtgctcgggcacgag
aacctcggcgtggtcgccgaaatcggcagcggcgtcgagcgcgtcaaggtcggcgaccac
gtgtgtctgccgttcaacatcggctgcggtttctgccgtaactgcgagaccggcatgccc
tcctactgcctgacggccaaccccgacccggagatggcgggggccgcctacggcttcgcc
ggcatgggtcctttctctggcgggcaggccgagtacctgcgcgtgccgttcggtgacttc
aactgcctgcggctgcccgaggacgcgcaggagaaggaggacgactacgtgatggtcgcc
gacatcttccccaccggctggcacgccacccgcctggccgggctcaaaccgggggagtcc
tgcgtcgtctacggcgcgggtccggtcggactgatggcggcctactccgcgctgctccag
ggggcgtcccaggtgatggtggtcgaccgccaccccgaccggctgcgcctggtcgagcaa
atgggggcgatcgccgtcgacgactccaagggcgacccggtcgagcagatcctcaacctc
accgacggccgccgcgcggactgcggctgtgagtgcgtcggttaccaggcccacgaccat
ctcggtgtcgagcaccccgagatgaccatgaacaacctggtgaagtcggtgaagttcacc
ggcggtatcggtgtcgtgggcatcttcctgccctccgatcccggagcgccggacgagatg
gcccgcaacggtcggctccccttcgagatggggacgttctggttccaggggcagaagatc
ggtaccggacaggcgccggtgaaggcctacaaccggcagctgcgggacatgatccaccgg
gaccgggcgaagccgtcctttatcgtgtcccacgacctgccgctgcagagggcaccggag
gcctacgagcgcttcgacaaccgcgaggacggctggaccaaggtggtgctcaagcccagc
ctggtgtga

DBGET integrated database retrieval system