KEGG   Nocardiopsis alba: B005_0630Help
Entry
B005_0630         CDS       T02218                                 

Definition
AAA domain family protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nal  Nocardiopsis alba
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B005_0630
Enzymes [BR:nal01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     B005_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(650286..652361)
Genome map
AA seq 691 aa AA seqDB search
MRSSHFPFSAIVGCDTEPLDDLGLSLVLTSVSPEIGGVLVRGEKGTAKSTAVRALASLLP
PIDVHRGDRFSVDPADPGQHSPDGPFGPETPVESRPVRLVELPVGATEDRVLGSLHLEQA
LTRGQVAYEPGLLARAHRGLLYVDEVNLLHDHLVDLLLDAAATGRVTVERDGFSVEHTAR
FLLIGTMNPEEGELRPQLLDRFGLTVEIAAPTEPRARAEVVRRRMAYDTDPAGFAERYRE
TERALSARIAEARDALDRVRLSEAALLKIAEVCAAFEVDGLRADIVTARTAVAHAAWEGR
TEVTRADIRRAATLALPHRRRRNPFDAPGLDEELLDRVLGEEELPPDPPEPSGPDGGDDP
VDTPPEGDGAPDAEGPEPTEGPADGPIGEETGPEPETIPEPAPHEPVGEDHPDSEPRPSA
APPPTAKAAAPYRPRTFTVRGTGEGADGRRSRAIGTRGRRVGASRPGPGRGSSLHLVETV
RAAASRPGEGERIRLRPEDLRVAIREGRESNLVLFCVDASGSMAARKRMTEVKTAILSLL
LDAYRRRDKVGLITFRGSTAELTLPPTRSVDVAAVRLDEMPAGGRTPLAEGLLEAARVVR
RERLRDARLRPLLVVVTDGRATGGRGAVGRALDAADHVAGLGVTTVVVDSESGPLRLGLA
ATLAARLDADHLPVGEVDADALSDAVRERAA
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
ttgcggtcttcgcactttcccttctccgcgatcgtcggttgcgacaccgaacccctcgac
gacctcggactctccctggtcctgaccagtgtctcgccggagatcggcggcgtcctggtc
cgcggcgagaagggcaccgccaagtccaccgcggtgcgggcgctggcctccctgctgccg
cccatcgacgtccatcgcggagaccgcttctccgtggacccggccgaccccggacagcac
tcgcccgatggtcccttcggccccgagaccccggtggagagccggccggtccggctggtc
gaactccccgtcggcgccaccgaggaccgggtcctgggctccctgcacctggagcaggcg
ctcacccgagggcaggtcgcctacgagcccggactgctggcccgagcccaccgcgggctg
ctctacgtcgacgaggtcaacctcctccacgaccacctggtcgacctcctgctggacgcg
gcggccaccggccgggtgaccgtcgaacgcgacggcttctccgtggagcacacggcccgc
ttcctgctcatcggcacgatgaacccggaggagggcgagctgcgcccgcagctcctcgac
cgcttcggactcaccgtggagatcgccgcgccgaccgagccccgtgcccgcgccgaggtg
gtccgacgccggatggcctacgacaccgacccggccggcttcgccgagcgctaccgcgag
accgagcgggccctgtccgcgcgtatcgccgaggcgcgcgacgccctggaccgggtccgg
ttgtccgaggcggcgctgctcaagatcgccgaggtgtgcgccgccttcgaggtcgacggt
ctgcgcgccgacatcgtcaccgcccgcacggcggtcgcgcacgccgcctgggagggacgg
accgaggtgacccgcgccgacatccgccgcgccgccaccctcgccctgccgcaccgacgc
agacgcaaccccttcgacgccccgggactggacgaggagctcctcgaccgggtcctgggc
gaggaggagctcccgcccgacccgccggaaccctcgggtccggacggcggcgacgacccc
gtcgacaccccgcccgagggcgacggcgcaccggacgccgaaggccccgaacccaccgag
ggcccggccgacgggccgatcggtgaggagaccggcccggagccggagacgatcccggag
cccgctccgcacgaacccgtgggcgaggaccaccccgactccgagccccggccgtccgcc
gccccgccccccacggccaaggcggccgccccctaccgcccccgtacgttcaccgtgcgg
gggaccggcgagggcgccgacggtcgacgcagccgcgccatcggaacccggggccgccgg
gtcggcgcctcccgccccggcccgggccggggctcctcgctccacctggtggagaccgtg
cgggccgccgcctcacgaccgggcgagggggagcggatccggctgcgtccggaggacctg
cgcgtcgcgatccgggagggcagggagagcaacctggtcctgttctgcgtcgacgcctcc
ggctccatggccgcgcgcaaacgcatgaccgaggtcaagaccgcgatcctctcgctcctg
ttggacgcctaccgcagacgcgacaaggtcggcctgatcaccttccgggggagcacggcc
gaactcacgctgccgcccacccgttcggtggacgtggccgccgtccgtctcgacgagatg
cccgccggcggccgcaccccgctcgccgaggggctgctggaggccgcccgagtggtccga
cgggaacgcctgcgcgacgcgcgcctgcgtccgctcctggtcgtggtcaccgacggccgg
gccaccgggggacggggcgccgtcggccgtgccctggacgccgccgaccacgtcgccgga
ctcggggtcaccacggtcgtggtggacagcgagtccggcccccttcgtctggggctggcc
gccaccctcgccgcccgcctggacgccgaccatctgcccgtcggcgaggtcgacgccgac
gccctgagcgacgccgtacgagaaagggccgcctga

DBGET integrated database retrieval system