KEGG   Nocardiopsis alba: B005_0818Help
Entry
B005_0818         CDS       T02218                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nal  Nocardiopsis alba
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nal00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834282..835781
Genome map
AA seq 499 aa AA seqDB search
MSQQYVAAIDQGTTSSRCILFDRDGRIVSVDQREHRQIFPKPGWVEHDALEIWTNVEAVV
QDSLRKSDITPDQIAAIGITNQRETTLLWDRETGEPVYNAIVWQDTRTDDLVRELGAQGG
QDRFRAKCGLPLATYFSGPKIRWLLDNVEGVRERADRGELMFGTMDTWLIWKMTGRHVTD
VTNASRTMLMNLETLAWDEEILAAMDIPRSLLPEIRSSSEVYGESNGYLAGVPVASSLGD
QHAALFGQTCFDPGDVKGTYGTGTFLVMNTGTEPVTSNNGLLTTLGYKIGDAPAVYALEG
SIAVTGSLVQWLRDNLGLISSAPEIETLARTVDDNGGCYIVPAFSGLFAPHWRSDARGVI
AGLTGYVNKGHIARAVLEASAWQTREVVDAMNADARIDLTTLKVDGGMTADNLLMQILSD
VLDAEVVRPMVAETTCLGAAYAAGLAVGYWPDIETLRANWHKAAEWNPKMPAEVRDREYH
NWNKAVRRTLDWVEHEDQA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcagtacgtcgccgcgatcgaccagggaaccacgtcgagtcgctgcatcctc
ttcgaccgggacggtcgcatcgtctcggtggatcaacgcgagcaccgacagatcttcccc
aagccggggtgggtcgaacacgatgccctggagatctggaccaacgtcgaggcggtggtg
caggactcgctccgcaagagcgacatcacccccgaccagatcgccgccatcggtatcacc
aaccagcgtgagaccaccctgctctgggaccgagagaccggcgagcccgtctacaacgcg
atcgtctggcaggacacccgcaccgacgacctggtccgcgaactgggcgcccaggggggc
caggaccgtttccgcgccaagtgcggcctgccactggccacctacttctccggccccaag
atccgctggctgctcgacaacgtcgagggagtccgcgagcgcgccgaccgcggcgagctg
atgttcggcaccatggacacctggctcatctggaagatgaccggccggcacgtcaccgac
gtgaccaacgccagccgcaccatgctgatgaatctggagacgctggcctgggacgaggag
atcctggccgccatggacatcccgaggagcctgctccccgagatccgctcctcctccgag
gtctacggcgagtcgaacggctacctggccggggtcccggtcgcctcctcgctcggcgac
cagcacgcggcgctgttcggccagacctgcttcgacccgggcgacgtcaagggcacctac
ggcaccggcaccttcctggtgatgaacaccggcaccgagcccgtcacctccaacaacggc
ctcctcaccaccctgggctacaagatcggcgacgccccggccgtgtacgccctggagggc
tccatcgcggtcaccggttcgctggtgcagtggctgcgcgacaacctcggtctgatcagc
agcgccccggagatcgagacgctggcgcgcacggtcgacgacaacggcggctgctacatc
gtcccggccttctccggcctgttcgccccgcactggcgcagcgacgcccgaggcgtcatc
gccggtctgaccggctacgtgaacaagggccacatcgcccgcgcggtcctggaggcctcg
gcctggcagacccgcgaggtcgtcgacgcgatgaacgccgacgcgcggatcgacctgacc
acgctcaaggtcgacggcggcatgaccgcggacaacctgctcatgcagatcctgtccgac
gtgctcgacgccgaggtcgtccggccgatggtcgccgagaccacctgtctgggcgccgcc
tacgcggccggtctggccgtgggctactggcccgacatcgagaccctgcgggccaactgg
cacaaggccgccgagtggaacccgaagatgccggccgaggtccgcgaccgcgagtaccac
aactggaacaaggccgtgcgccgcaccctcgactgggtggagcacgaggaccaggcgtaa

DBGET integrated database retrieval system