KEGG   Nocardiopsis alba: B005_0908Help
Entry
B005_0908         CDS       T02218                                 

Definition
glycosyl hydrolase family 3 C-terminal domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nal  Nocardiopsis alba
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nal00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:nal00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(937896..939569)
Genome map
AA seq 557 aa AA seqDB search
MKPRALVPVCAGLALMISACTTTPEEVGSSPEDNEQNPGASAEPFEPVLAPRLLAEMDLD
DKIGQLLVLSAQGTTAEENASLIETHHPGGLIYFDANLDDAEQIARMSAGVQEIAAEQGQ
GVPLFLGIDQEQGRVVRMPVGTLFPDAMAVGATGDTELAALRAATTANELTAVGINLNYA
PDADVNTDPNNPVIGIRSFGSDPDAVAEMVLAEADAYAENGVVPVAKHFPGHGDTDVDSH
SGLPVIDLPRDRWEAEHLPPFRAAVEAGIDSIMTAHVLMPGLESDEDPDPATLSPTLIDG
ILRDELGYDGVVTTDALNMDGVRQRHSDGEVAVRVIEAGVDQLLMPPNPEEAVAAIHEAV
ESGRIDEERIDRSVLRILTLKEKRGILEAEPIDPAAATSAMEDPDHAEAAQRVADASVTL
LRNENDLLPLAAGTDVRVTGTGADRIAPALADAGMNVVESGEAVLVVGTSGARSSEEQRS
LVASGRAQGTPVVVVSQDGPYDLEAFPDVDGYLALYSAVEVSRVAAARVISGQVEPTGTL
PVDIPAVDMGIGTGLRY
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcgcgccctggtcccggtctgcgcaggcctggccctgatgatcagtgcatgt
accacgacccccgaggaggtgggttcctcgcctgaggacaacgaacagaacccgggcgcc
tcggccgagcccttcgagccggtcctggctccgcggttgctcgccgagatggacctggac
gacaagatcggccaactcctggtcctgtccgcgcagggcaccacggccgaggagaacgcc
tcgctgatcgagacccaccaccccggcgggctcatctacttcgacgccaacctcgacgac
gccgagcagatcgcccggatgtcggcaggggtccaggagatcgccgccgaacaggggcag
ggggtcccgctgttcctcggcatcgaccaggaacaggggcgcgtcgtgcgcatgccggtg
ggaaccctgttccccgacgcgatggcggtcggcgccaccggcgacaccgaactcgccgcc
ctgcgcgcggccaccacggcgaacgagctcaccgcggtggggatcaacctcaactacgcc
cccgacgccgacgtcaacaccgacccgaacaacccggtgatcggtatccgctccttcggc
tccgacccggacgcggtggcggagatggtgctggccgaggccgacgcctacgccgagaac
ggcgtggtgccggtcgccaagcacttccccggccacggcgacaccgacgtcgacagccac
agcggtctccccgtcatcgaccttcccagggaccgttgggaggccgagcacctgccgccc
ttccgagcggcggtcgaagcgggcatcgactcgatcatgaccgcccacgtgctcatgccg
gggctggagagcgacgaggaccccgacccggccaccctctccccgacgctcatcgacggc
atcctgcgcgacgagctcggctatgacggcgtggtcaccaccgacgccctcaacatggac
ggtgtgcgccagcgccactccgacggagaggtcgcggtccgggtcatcgaggccggtgtc
gaccagctcctgatgcccccgaaccccgaggaggcggtcgccgccatccacgaggccgtg
gagagcggacggatcgacgaggaacgcatcgaccgctccgtcctgcgcatcctcaccctc
aaggagaagcgcggcatcctggaggccgagccgatcgatccggccgccgccacctccgcc
atggaggaccccgaccacgccgaggccgcccagcgggtggccgacgcctcggtcaccctc
ctgcgcaacgagaacgacctcctgccgctcgccgcgggcaccgacgtccgggtcaccggg
acgggggccgaccggatcgcccccgctctcgccgacgccggcatgaacgtggtggagagc
ggagaggccgtcctggtcgtgggcaccagcggagcccggagctccgaggagcagcgttcc
ctggtcgcctccgggcgggcccagggcacccccgtcgtcgtggtctcccaggacggcccc
tacgacctggaggccttccccgacgtcgacggctacctcgccctctactcggcggtggag
gtctcccgggtcgcggcggccagggtcatctccggccaggtcgaacccaccgggaccctt
ccggtggacatccccgcggtcgacatgggcatcggtaccggactccgatactga

DBGET integrated database retrieval system