KEGG   Nocardiopsis alba: B005_0946Help
Entry
B005_0946         CDS       T02218                                 

Gene name
cofE
Definition
gamma-glutamyl ligase (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
nal  Nocardiopsis alba
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:nal00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
983849..985144
Genome map
AA seq 431 aa AA seqDB search
MSVELRIRGLLGIPEVRSGDDLAELVAEAVAGSGRPLVDGDVLVVTSKIVSKAEGRSVRM
DREKAIDAETERVVARMGRTRIVQTRQGLVMAAAGVDASNVEPGTVLLLPEDSDVSARTL
RAGILDRLGVHVGVVISDTFGRPWREGQTDVAIGAAGLRALQDLRGTTDAHGNLMEATIN
AIADEVAGAGELVKGKTSAIPVAVISGLGDLVTEEDGPGAAELVRPADEDMFRYGSRDVV
PARRTVRSFSDRPVDPALVRRAVASAITAPAPHHTTPWRFVLVESPETRERLLDAMLRAW
VEDLRGDGFTEEQIARRTRRGDVLRRAPYLVVPFLVADGAHPYPDERRADAERSMFLVAM
GAGVQNLLVGLAMEGLGSAWISSTMFCADVVREVLEVPEEWRPMGAVAVGYAAEPPKDRP
PRDPEDFVVVR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgaactgcggatacgcggtcttctcggcatcccggaggtccgttcgggcgac
gatctcgcggaactggtggccgaggccgtggccggttccggccggcccctggtcgacggg
gacgtgctcgtcgtcacctccaagatcgtctccaaggcagagggacgttcggtccggatg
gaccgcgagaaggccatcgacgccgagaccgagcgggtcgtcgcccgcatggggcgcaca
cggatcgtgcagacccggcaggggttggtgatggcggcggcgggagtggacgcctccaac
gtcgagccgggcaccgttctgctgttgcccgaggactccgacgtctccgcgcgaaccctg
cgggccggaatcctcgaccgtctgggcgtgcacgtgggcgtggtgatctccgacaccttc
ggacgcccctggcgagaggggcagacggacgtggccatcggggcggccgggctgcgcgcg
ctccaggacctgcgcggcacgaccgacgcccacggcaacctcatggaggcgacgatcaac
gcgatcgccgacgaggtggcgggcgccggtgagctggtcaagggcaagacctccgcgata
ccggtggccgtgatctccggcctgggcgatctggtgaccgaggaggacggtccgggggcg
gccgagctcgtgcggcccgccgacgaggacatgttccgttacgggtcgcgtgacgtggtc
ccggcccgacggaccgtgcgctccttctccgaccgtccggtcgacccggccctggtacgt
cgcgcggtcgcctcggcgatcaccgcgccggccccgcatcacaccactccgtggcggttc
gtcctggtggagtcgcccgagacccgcgaacgtctgttggacgcgatgctccgggcctgg
gtggaggacctgcgcggggacggtttcaccgaggaacagatcgcacgacggacccggagg
ggcgacgtcctgcgtcgggccccctatctggtggtgcccttcctggtcgccgacggggcc
cacccgtatccggacgagcgtcgtgccgacgccgagcggtccatgttcctggtcgccatg
ggcgccggggtacagaacctgctggtgggcctggccatggagggtctcgggtcggcctgg
atctcctccacgatgttctgcgcggacgtggtccgcgaggtgctggaggtcccggaggag
tggcgtccgatgggggccgtggccgtggggtacgcggccgaaccgcccaaggaccgtccg
ccccgtgatccggaggacttcgtcgtggtgcgctga

DBGET integrated database retrieval system