KEGG   Nocardiopsis alba: B005_1157Help
Entry
B005_1157         CDS       T02218                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nal  Nocardiopsis alba
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:nal01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:nal01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1203031..1204002
Genome map
AA seq 323 aa AA seqDB search
MTTAPELPAEGTATTRPKREAIPEYEPELRGKAERYTVFAFVFVPLLALLGAVPFFWGWG
LSVTDIVIAVVFYVISGLGITVGFHRHFTHGSFRANRPLRIALAIAGSMAIEGSVIKWVA
DHRRHHKYADAEGDPHSPWRFGDDWKSVAKGMYYAHMAWMYLDEKKTSPRRFTPDLLKDK
DVVLVDRLFVPIVLFSLFAPAAIGGLVTMSWWGAVTAFFWAGLVRVALLHHVTWSVNSIC
HTIGEENFEVRDRSRNVWWLAIPSFGESWHNLHHADPTCARHGVLKGQIDISARVIWAFE
KIGWATKVRWPNNERLAAKRVKV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgctcccgaactacccgcggaaggcaccgccacgacgcgccccaaacgcgag
gcgatccccgagtacgagcccgagctgaggggcaaggccgagcgctacaccgtgttcgcc
ttcgtcttcgtgccgctcctcgcgctcttgggcgcggtgcccttcttctggggctggggc
ctgtcggtgacggacatcgtcatcgccgtggtcttctacgtgatcagcggtctcggcatc
accgtcggcttccaccggcacttcacgcacggttccttccgtgccaaccggccgctgcgg
atcgccctggcgatcgcgggcagcatggccatcgagggcagcgtcatcaagtgggtggcc
gaccaccgccgccaccacaagtacgccgacgccgagggcgacccgcactccccgtggcgc
ttcggcgacgactggaagtccgtggccaagggcatgtactacgcccacatggcctggatg
tacctggacgagaagaagacctctccgcgccgcttcaccccggacctgctcaaggacaag
gacgtcgtcctcgtcgaccgactgttcgtgccgatcgtgctcttctccctgttcgccccg
gccgccatcggtggcctggtgaccatgtcctggtggggcgccgtcaccgcgttcttctgg
gccggtctggtccgtgtcgcgctgctgcaccacgtcacctggtcggtcaactccatctgc
cacaccatcggcgaggagaacttcgaggtgcgcgaccgctcccgcaacgtgtggtggctg
gccatcccctccttcggcgagtcctggcacaacctgcaccacgccgacccgacctgcgca
cgtcacggcgtcctcaagggtcagatcgacatctccgcccgggtcatctgggccttcgag
aagatcggctgggccaccaaggtccgctggcccaacaacgaacgactcgccgcgaagcgg
gtcaaggtctag

DBGET integrated database retrieval system