KEGG   Nocardiopsis alba: B005_1169Help
Entry
B005_1169         CDS       T02218                                 

Definition
glutathione peroxidase family protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nal  Nocardiopsis alba
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    B005_1169
  Metabolism of other amino acids
   00480 Glutathione metabolism
    B005_1169
Enzymes [BR:nal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     B005_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1212677..1213168)
Genome map
AA seq 163 aa AA seqDB search
MADLDSIPVTLIDGRETTFGEWAGKVRLVVNVASRCGLTSQYGALEELQKRYADRGFTVI
GFPSNQFLQEFGGDDKIAEYCSMTWGVTFPMTTKTKVNGRGRHPLYEELTRVPDAGGSAG
RIRWNFEKFLILPDGTTHRFRPTTVPDAPEIVDLIEGSLPEGA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctggactcgatcccggtcaccctgatcgacggacgcgagaccaccttcggc
gagtgggccgggaaggtgcgcctggtggtgaacgtggcgtcccgctgcgggctcacctcc
cagtacggcgcgctggaggagctccagaagcgctacgccgaccgcggcttcacggtcatc
ggctttcccagcaaccagttcctccaggagttcggcggcgacgacaagatcgccgagtac
tgctcgatgacctggggcgtcacctttccgatgaccaccaagacgaaggtcaacgggcgc
ggacgccaccccctctacgaggagctcacccgggtccccgacgccggggggagcgccgga
cggatcaggtggaacttcgagaagttcctgatcctgccggacggaacgacgcaccggttc
cggccgaccacggtgcccgacgcccccgagatcgtcgacctcatcgagggttccctgccc
gagggggcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system