KEGG   Nocardiopsis alba: B005_1265Help
Entry
B005_1265         CDS       T02218                                 

Definition
mobA-like NTP transferase domain protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nal  Nocardiopsis alba
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:nal00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nal00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nal00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nal00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1320293..1321111)
Genome map
AA seq 272 aa AA seqDB search
MLPIVDKPAIQYVVEEAVESGLHDVLMITGRSKRSIEDHFDRAYELEEALAAKGEEGKLR
SVRESSDLAQVHYVRQGEPRGLGHAVLCAEAHVGDNPFAVLLGDDLIESADLLRRMIEVR
QEHGGSVVALMEVEPEQVSLYGCAAVEPTEEDDVVTVTDLVEKPSQEEAPSRWAIIGRYI
CDPEVFSVLHRTPPGRGGEIQLTDALLELARTKPEDGGGVRGVLLRGRRYDTGNKADYIR
TVVDFACRRPDLAEELLPWLREFVDRQGEGRV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgatcgtggacaaacccgcgatccagtacgtggtggaggaggcggtcgaatcg
ggtcttcacgacgtcctcatgatcaccggacgcagtaagcgttccatcgaggaccacttc
gatcgggcctatgagctggaggaggccctcgcggccaagggcgaggagggcaaactccgc
tccgtccgcgagtccagcgacctggcccaggtccactacgtccgccaaggggagcctcgc
gggctcgggcacgcggtcctgtgcgcggaggcgcatgtgggcgacaaccccttcgcggtg
ctcctcggcgacgacctgatcgagtcggcggacctgctgcgccgcatgatcgaggtccgc
caggagcacggcgggagcgtcgtcgcgctcatggaggtggagcccgaacaggtctccctc
tacgggtgcgcggcggtggagccgacggaggaggacgacgtcgtcaccgtcaccgatctg
gtcgagaagccctcccaggaggaggcgcccagccgctgggcgatcatcggccgttacatc
tgcgaccccgaggtcttctccgtcctgcaccgcaccccgcccggccgcggcggcgagatc
cagctgaccgacgccctgttggagctggcccgcaccaagcccgaggacgggggcggtgtg
cgaggcgtcctgttgcgcgggcgccgctacgacacggggaacaaggccgactacatccgc
acggtggtggacttcgcctgccgccgtcccgacctggccgaggagctcctgccctggctg
cgcgagttcgtggaccgtcagggtgaagggcgcgtctga

DBGET integrated database retrieval system