KEGG   Nocardiopsis alba: B005_1379Help
Entry
B005_1379         CDS       T02218                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nal  Nocardiopsis alba
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B005_1379
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B005_1379
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B005_1379
Enzymes [BR:nal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B005_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1429135..1430394)
Genome map
AA seq 419 aa AA seqDB search
MAIAATEPTAVRAFGPGTALSCRECGERYELSPIFACGFCFGPLEVAYDFGNVSREEIES
GPKNIWRYRSLLPVPDNVAELPNMNPGLTPLVRADRLAAELGLSSLHVKDDSGNPTHSFK
DRVVAIAVEAARTFGFTTLSCSSTGNLAGAVGAAAARAGFESCVFIPAGLEEGKVVMAAV
YGGKVVAIDGNYDDVNRFCSELIGDPAGESWGFTNVNLRPYYAEGSKTLAYEIAEQLGWR
LPDQIVIPIASGSQLTKIDKGFQELIKVGLVEDRPYKVFGAQATGCSPVAKAWESGHDVI
QPVKPDTIAKSLAIGNPADGPYVLDIAQRTGGSIEHVGDDEIVDAIKLLARTEGIFAETA
GGVTTGVLRKLVREGKLDTEAETVIVNTGDGLKTLNAVDAGVTATIKPSLKAFTEAGLA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgccgccactgaacccaccgccgtccgcgccttcggcccggggaccgccctc
tcctgtcgggagtgcggcgaacgctacgagctctcgccgatcttcgcctgtggcttctgt
ttcggccccctcgaggtcgcctacgacttcgggaacgtctcccgtgaggagatcgagagc
ggccccaagaacatctggcgctaccgctccctcctgccggtccccgacaacgtggccgag
ctcccgaacatgaaccccggtctgacccccctggtccgcgccgaccgtctggccgccgaa
ctcggcctctcctccctgcacgtcaaggacgactccggcaaccccacgcactccttcaag
gaccgcgtggtcgcgatcgccgtcgaggccgcccgcaccttcgggttcaccaccctgtcc
tgctcctccaccggcaacctcgccggagcggtcggcgccgccgccgcccgggccggcttc
gagtcctgcgtgttcatccccgcggggctcgaggagggcaaggtcgtcatggccgcggtc
tacggcggcaaggtcgtcgcgatcgacggcaactacgacgacgtcaaccgcttctgctcc
gagctcatcggcgacccggccggcgagagctggggcttcaccaacgtcaacctgcggccc
tactacgcggagggctccaagacgctggcctacgagatcgccgaacagctcggctggcgg
ctgcccgaccagatcgtcatcccgatcgcgtccggctcccagctcaccaagatcgacaag
ggcttccaggagctgatcaaggtcggcctggtcgaggaccgcccctacaaggtcttcggc
gcccaggccaccggctgctccccggtggccaaggcctgggagagcggccacgacgtcatc
cagccggtcaagccggacaccatcgccaagtcgctggccatcggcaacccggcggacggg
ccctacgtcctcgacatcgcccagcgcaccggcggctccatcgagcacgtgggcgacgac
gagatcgtcgacgccatcaagctcctcgcccgtaccgagggcatcttcgccgagaccgcg
ggcggcgtgaccaccggcgtcctgcgcaagctggtccgtgaggggaagctcgacaccgag
gcggagaccgtcatcgtcaacaccggcgacgggctcaagaccctcaacgcggtcgacgcg
ggcgtcaccgccaccatcaagccctcgctgaaggcgttcacagaggccgggctggcctga

DBGET integrated database retrieval system