KEGG   Nocardiopsis alba: B005_1737Help
Entry
B005_1737         CDS       T02218                                 

Definition
class II Aldolase and Adducin N-terminal domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
nal  Nocardiopsis alba
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nal00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1812139..1812804
Genome map
AA seq 221 aa AA seqDB search
MLLEQERRDVCLTARSIARHPGTAPGEAGTISVRSGDLVVVTPHGIPLEQLGPGDCPVMS
LDDRVLEGRRDPAAEATLHLAVHRDAAEHGRDVGAVVNAFTIDTVAVSTVLVELPPIHHR
AAGLGGAVAVTPYAPYGTGDISDQAVKALKGRDAALLAGHGGLALGRNLEHALENLRLLD
WLSGTYLRARQVGEPRVLSEEELAEIRHRDTYGWAGPDPFL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcgaacaagaacgtcgcgacgtctgcctgacggcccggtccatcgcccgacac
cccggcaccgcgcccggcgaggcgggcaccatcagcgttcgcagcggggacctcgtggtc
gtcaccccgcacggaatccccctggaacagctcggccccggcgactgccccgtcatgtcc
ctggacgaccgtgtgctggaaggacggcgcgaccccgccgccgaggccaccctccacctg
gccgtccaccgcgacgcggccgaacacggtcgcgacgtcggcgcggtcgtcaacgccttc
accatcgacaccgtggccgtgtcgaccgtgctggtcgaactccctcccatccaccaccgc
gccgccggtctgggtggcgccgtcgccgtcaccccctacgccccttacggcaccggcgac
atctccgaccaggcggtcaaggccctcaaggggcgcgacgccgccctgttggccggccac
ggaggtctcgccctcggccggaacctggagcacgccctggagaacctgcggctgctcgac
tggctcagtggcacctacctgcgcgcccgtcaggtcggcgaaccgcgcgtgctgtccgag
gaggagctcgccgagatccgtcaccgcgacacctacggctgggccggacccgaccccttc
ctctag

DBGET integrated database retrieval system