KEGG   Nocardiopsis alba: B005_1933Help
Entry
B005_1933         CDS       T02218                                 

Definition
short chain dehydrogenase family protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
nal  Nocardiopsis alba
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    B005_1933
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    B005_1933
Enzymes [BR:nal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     B005_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1999263..1999979
Genome map
AA seq 238 aa AA seqDB search
MTGAAGGIGRACATRLADAGATVRLVDIDGAALAELAELGVGEPVELDLTDLDAAEEAAR
GSDIVVNNAGVQTVAAVQDFPPERFSLILRLMVESPFRVVRGALPHMYERGWGRIVNISS
VHGLRASAYKSAYVAGKHGLEGFSKVVALEGAPHGVTSNCVNPGYVRTALVERQIAEQAE
AHGLPEDRVVSEVLLARTPVKRLIEPSEVAEMVAYLCSDDASFVNGASLPIDGAWSSS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcgccgccggcggtatcgggcgggcgtgcgcgacgcgtctggccgacgccgga
gccaccgtccgtctggtcgatatcgatggcgccgccctcgccgaactcgccgaactgggc
gtgggcgaaccggtggaactggacctgaccgacctggacgccgccgaggaggcggcgcgg
gggtccgacatcgtggtgaacaacgccggggtgcagacggtcgccgccgtacaggacttc
cctccggagcgtttctccctcatccttcgactcatggtcgagtcaccgttccgcgtggtg
cgcggggccctgccgcacatgtacgagcgcggctggggccggatcgtcaacatctcgtcc
gtgcacggcctccgcgcctccgcctacaagtcggcgtacgtggccggcaaacacgggctg
gaggggttctccaaggtggtcgcgctcgaaggcgccccacacggggtgacctccaactgt
gtgaaccccggatacgtgcggaccgccctggtggagcggcagatcgcggagcaggccgag
gcgcacggcctccccgaggaccgtgtggtctcggaggtgcttctggcccgcacccccgtg
aaacggctgatcgaaccgtccgaagtggccgagatggtcgcctatctgtgctccgacgac
gcctcgttcgtcaacggggcgtccctgcccatcgacggagcctggagttcgagctga

DBGET integrated database retrieval system