KEGG   Nocardiopsis alba: B005_2557Help
Entry
B005_2557         CDS       T02218                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nal  Nocardiopsis alba
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B005_2557 (folE)
Enzymes [BR:nal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     B005_2557 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2671047..2671613
Genome map
AA seq 188 aa AA seqDB search
MDRERVARAVREILIAIGEDPDRDGLLETPDRVARAYEEQFAGLGQKPGDVLTTVFEAGH
EEMVLVKDIELYSTCEHHLVPFYGVAHVGYIPGEDGRITGLSKLARLVDVYARRPQVQER
LTGEVADAIMQHLEPRGVIVVIEAEHLCMTMRGVRKPGAQTVTSAVRGIFRSSDRTRAEA
MSLILDRR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtggaccgcgagcgtgtcgcccgcgccgtccgcgagatcctcatcgcgatcggcgaggac
ccggatcgggacggtctcctggagacccccgaccgggtcgcccgggcctacgaggaacag
ttcgccggtctcggccagaagccgggtgacgtgctcaccacggtcttcgaggccgggcac
gaggagatggtcctggtcaaggacatcgagctgtactcgacctgcgaacaccacctcgtc
ccgttctacggagtggcgcacgtgggctacatcccgggggaggacggccgcatcaccggg
ctcagcaagctcgcccgtctcgtggacgtctacgcccgccgtccccaggtgcaggagcgt
ctgaccggcgaggtcgccgacgcgatcatgcagcacctcgaaccgcgcggcgtgatcgtg
gtgatcgaggccgagcacctgtgcatgaccatgcgcggtgtgcgcaagcccggtgcccag
acggtgacctcggccgtccgggggatcttccggagcagcgaccgcacccgggccgaggcc
atgagcctcatcctcgaccggcgctga

DBGET integrated database retrieval system