KEGG   Nocardiopsis alba: B005_2558Help
Entry
B005_2558         CDS       T02218                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nal  Nocardiopsis alba
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B005_2558
Enzymes [BR:nal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     B005_2558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2671759..2672610
Genome map
AA seq 283 aa AA seqDB search
MGVVNVTPDSFSDGGSWFDPGRAIEHGLRLVEEGADIIDVGGESTRPGAQRVEASEELRR
VEPVVRALTARGVAVSVDTMRAEVAARAVDAGAVLVNDVSGGLADPEMARLVASSGVAYV
LMHWRGHSHDMESRAVYTDVVQEVLDELRDRMEAMISAGVDPGQIVLDPGLGFSKRPERA
HNWALLHRLERFHELGRPVLVAGSRKRFLSRLLSDGKGEERPFVECDAATTALTTLSADR
GAWAVRVHDVRPNADAVRVAAAWSDGGAALHGGRAEIMDRGGL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggggtcgtcaacgtcacccccgactccttctccgacggcggttcgtggttcgatccc
gggcgcgcgatcgaacacggactccgcctggtcgaggagggggccgacatcatcgacgtg
ggcggcgagtccacccgccccggcgcccaacgggtggaggcgtccgaggaactgcgcagg
gtcgaaccggtcgtccgggctctcaccgcgcggggggtcgccgtcagcgtcgacacgatg
agggccgaggtcgcggcacgcgcggtcgacgccggagcggtattggtcaacgatgtcagt
ggtggtctggccgaccccgagatggcacgattggtcgcttcttccggtgtggcctacgtg
ttgatgcactggcgtgggcatagtcatgacatggagagccgtgccgtgtacacggatgtc
gtccaggaggtcctcgatgagctccgcgaccgtatggaggccatgatcagtgcaggtgtc
gaccccgggcagatcgttctggatccggggctgggattctccaaacgtcccgaacgggcg
cacaactgggcgctgctccaccgactcgaacgtttccatgaactgggccggccggttctg
gtcgccggttcccgcaagcgcttcctcagccgtctgttgagcgatggcaagggggaggag
cgccccttcgtggaatgcgacgccgccacgacggctctgacgaccctgtccgcggacagg
ggggcctgggcggtgcgggtgcacgacgtccgccccaacgccgacgccgtccgggtcgcc
gcggcctggtccgacggcggggcggccctccacggaggacgcgccgagatcatggaccgg
ggcggcctgtga

DBGET integrated database retrieval system