KEGG   Nocardiopsis alba: B005_2561Help
Entry
B005_2561         CDS       T02218                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nal  Nocardiopsis alba
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B005_2561 (folK)
Enzymes [BR:nal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     B005_2561 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2673421..2673957
Genome map
AA seq 178 aa AA seqDB search
MTRAVLSLGSNLGDRRATLQGAVDHLLAGPDAPTAVALSPVYETAPVGGPEQGAFLNVVL
VVDTPGTARGLLERAQDAERAFERVREVRWGPRTLDVDVIAFGDTVDEDPVLTLPHPRAH
LRAFVLRPWLDTDPAAIVPGRGPVAALLATVEEEDTAGEQELTRRDDLRLRTPGEAER
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgacacgtgccgtgctctccctgggctccaacctcggggaccggagggcgacactccag
ggcgccgtggaccacctcttggccggaccggacgccccgacggcggtggcgctctcaccc
gtctacgagaccgcgcccgtgggcggccccgaacagggggccttcctcaacgtcgtcctg
gtcgtggacaccccgggcaccgcgcgagggcttctggaacgggcccaggacgccgaacgg
gccttcgagagggttcgggaggtccgctggggtccccgcaccctggacgtcgacgtgatc
gccttcggggacaccgtcgacgaggacccggtcctgacccttccgcacccgcgagcccac
ctgcgcgccttcgtcctccgtccctggctggacaccgaccccgcggccatcgtgcccggc
cggggcccggtcgcggctctgctcgccaccgtggaggaggaggacacggccggcgaacag
gagctgacccgcagggacgacctgaggcttcgaaccccgggagaggcggaacgctga

DBGET integrated database retrieval system