KEGG   Nocardiopsis alba: B005_2746Help
Entry
B005_2746         CDS       T02218                                 

Gene name
echA1
Definition
(GenBank) enoyl-CoA hydratase EchA1
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nal  Nocardiopsis alba
Pathway
nal00071  Fatty acid degradation
nal00280  Valine, leucine and isoleucine degradation
nal00281  Geraniol degradation
nal00310  Lysine degradation
nal00360  Phenylalanine metabolism
nal00362  Benzoate degradation
nal00380  Tryptophan metabolism
nal00410  beta-Alanine metabolism
nal00627  Aminobenzoate degradation
nal00640  Propanoate metabolism
nal00650  Butanoate metabolism
nal00903  Limonene and pinene degradation
nal00930  Caprolactam degradation
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01120  Microbial metabolism in diverse environments
nal01130  Biosynthesis of antibiotics
nal01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B005_2746 (echA1)
   00650 Butanoate metabolism
    B005_2746 (echA1)
  Lipid metabolism
   00071 Fatty acid degradation
    B005_2746 (echA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B005_2746 (echA1)
   00310 Lysine degradation
    B005_2746 (echA1)
   00360 Phenylalanine metabolism
    B005_2746 (echA1)
   00380 Tryptophan metabolism
    B005_2746 (echA1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B005_2746 (echA1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B005_2746 (echA1)
   00281 Geraniol degradation
    B005_2746 (echA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B005_2746 (echA1)
   00627 Aminobenzoate degradation
    B005_2746 (echA1)
   00930 Caprolactam degradation
    B005_2746 (echA1)
Enzymes [BR:nal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     B005_2746 (echA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFR06029
UniProt: J7L5K7
Position
2853014..2853778
Genome map
AA seq 254 aa AA seqDB search
MSDEVLYTAEDGVAVITINRPKAKNAVNAAVAARIAEALDDIDSRSDVSVGIITGAGGTF
CAGMDLKAFMKGEVPVVEGRGFGGFAERGPKKPLIAAVEGYALAGGFEAVLACDLVVAAE
DARFGIPEVKRGLVAGAGGLLRLQHRIPRNIAMEFALTGDFVEAGRLAELGLVNQVTESG
GALEGAKALAARITPNGPLAVKVSKEIIRASDDWSGDEMWDRQNELAGPVFVSQDAMEGA
IAFAEKRAPVWKGE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacgaggttctctacacggccgaggacggcgtcgccgtcatcaccatcaaccgg
cccaaggccaagaacgcggtgaacgcggcggtcgcggcgaggatcgccgaggcgctcgac
gacatcgactcccgctccgacgtctccgtcgggatcatcaccggcgccggcggcaccttc
tgcgccggcatggacctcaaggccttcatgaagggcgaagtcccggtggtggaggggcgc
gggttcggcggcttcgccgagcggggcccgaagaagccgctcatcgccgcggtcgagggt
tacgctctggccggcgggttcgaggcggtactcgcctgcgacctggtcgtggcggcggag
gacgcccgcttcggcatccccgaggtcaagcggggactggtcgccggagccggaggcctc
ctgcgtctccagcaccgcatcccgcgcaacatcgcgatggagttcgccctcaccggcgac
ttcgtcgaggccgggcgcctggcggaactgggactggtcaaccaggtcaccgagagtggc
ggagcgttggagggcgccaaggccctggcggctcgtatcacccccaacgggcctctcgcg
gtgaaggtctccaaggagatcatccgtgcctcggacgactggtccggcgacgagatgtgg
gaccgccagaacgagctggccggcccggtgttcgtcagccaggacgcgatggagggggcg
atcgccttcgccgagaagcgcgcccccgtatggaagggcgaatga

DBGET integrated database retrieval system