KEGG   Nocardiopsis alba: B005_2847Help
Entry
B005_2847         CDS       T02218                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nal  Nocardiopsis alba
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B005_2847 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B005_2847 (sucC)
   00640 Propanoate metabolism
    B005_2847 (sucC)
   00660 C5-Branched dibasic acid metabolism
    B005_2847 (sucC)
Enzymes [BR:nal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     B005_2847 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2966510..2967691
Genome map
AA seq 393 aa AA seqDB search
MDLFEYQAKELFAEYGVPVPQGKVASTAAEARAIADEFAAAGKPRVVVKAQVKTGGRGKA
GGVKVAEGPEDAQAKAEQILGMDIKGHTVHRVLVEEASDIAEEYYFSFLLDRANRDFLSI
CSAEGGMEIEEVAETNPDAVAKISINALQGAPADIAAEIVKAGKLPEAAAAGAAEVITKL
WDAFVGKDATLVEVNPLILTKDGRVVALDGKVTLDENAEFRQDLESLTFAEEGDPLEVAA
KAKGLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEEHGGVKPANFLDIGGGASAEVMAN
GLEIILGDPAVKSVFVNVFGGITACDAVANGIVQALELLEERGDDVSKPLVVRLDGNNAE
LGRKILDDRAHPAVRRVDTMDGAAAQAAELAAK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgaataccaggcgaaggaactcttcgcagagtacggggttcccgtaccc
caggggaaggtggcgagcacggccgctgaggcgcgtgccatcgctgatgagttcgccgcc
gcgggcaagccccgcgtcgtcgtgaaggcccaggtcaagaccggtggccgtggtaaggcc
ggcggcgtcaaggtcgccgagggccccgaggacgctcaggccaaggccgagcagatcctc
ggaatggacatcaagggccacacggtccaccgtgtcctggtcgaggaggcgagtgacatc
gccgaggagtactacttctccttcctcctggaccgcgccaaccgtgacttcctctccatc
tgctccgccgagggcggcatggagatcgaggaggtcgccgagaccaaccccgacgccgtc
gcgaagatctcgatcaacgcgttgcagggcgctccggcggacatcgccgccgagatcgtc
aaggcgggcaagctgcccgaggccgccgccgccggtgcggccgaggtcatcaccaagctg
tgggacgccttcgtcggcaaggacgccaccctggtcgaggtgaacccgctcatcctgacc
aaggacggccgggtcgtcgccctcgacggcaaggtgaccctggacgagaacgccgagttc
cgccaggacctggagagcctgaccttcgccgaggagggcgaccccctggaggtcgccgcc
aaggccaagggtctcaactacgtcaagctcgacggcgaggtcggcatcatcggtaacggt
gccggtctggtcatgtcgaccctggacgtggtcgcctacgccggtgaggagcacggtggg
gtcaagcccgccaacttcctcgacatcggtggcggtgcctcggccgaggtcatggccaac
ggcctggagatcatcctgggcgaccccgccgtcaagagcgtgttcgtcaacgtcttcggt
ggcatcaccgcctgcgacgccgtcgcgaacggcatcgtccaggcgctggagcttctggag
gagcgcggcgacgacgtcagcaagccgctggtcgtccgtctggacggcaacaacgccgag
ctgggccgcaagatcctcgacgatcgcgcccacccggccgttcgacgggtcgacactatg
gacggcgccgccgctcaggccgccgagctcgcggcgaagtag

DBGET integrated database retrieval system