KEGG   Nocardiopsis alba: B005_3192Help
Entry
B005_3192         CDS       T02218                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nal  Nocardiopsis alba
Pathway
nal00260  Glycine, serine and threonine metabolism
nal00750  Vitamin B6 metabolism
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01120  Microbial metabolism in diverse environments
nal01230  Biosynthesis of amino acids
Module
nal_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B005_3192
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B005_3192
Enzymes [BR:nal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B005_3192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C FokI_N
Motif
Other DBs
NCBI-ProteinID: AFR07146
UniProt: J7L330
Position
3325681..3326739
Genome map
AA seq 352 aa AA seqDB search
MARAWRGIVEEYRDRLPVNENTPVVTLQEGGTPLLPATRVSELTGCEVFLKVEGLNPTGS
FKDRGMTMAISKAAEDGAKAVICASTGNTSASAAAYAIRAGMTCAVLVPQGKIAMGKLAQ
ALVHGARLLQVDGNFDDCLELARKLSVDYPVALVNSVNPYRLQGQKTAAFEIVDALGDAP
DIHCIPVGNAGNITAYWMGYTEYARDGISTGSPRMLGFQASGSAPIVDGAPVTSPSTIAT
AIRIGNPASWKLAEQARDESGGAIDKVTDRQIMAAYKLLAAEEGVFVELASAASVAGLLQ
ASAAGQVPKGSRIVCTVTGNGLKDPDWALAGASSATTVPVDAQAAAKALDLA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcacgggcgtggcgaggcatcgtcgaggagtaccgagaccgccttcccgtcaacgag
aacacccccgtcgtcaccctccaggagggcggcacccccctgctgcccgccacgcgtgtg
tccgagctcacgggctgcgaggtcttcctcaaggtcgaggggctcaaccccaccggttcc
ttcaaggaccgcgggatgaccatggccatctccaaggcggccgaggacggtgcgaaggcc
gtcatctgcgcctccaccggcaacaccagcgccagtgcggccgcctacgccattcgcgcc
ggcatgacctgcgccgtcttggtgccccagggcaagatcgccatgggcaagctcgcccag
gcgctcgtgcacggcgcccgactgctccaggtcgacggcaatttcgacgactgtctggaa
ctcgcccgcaagctcagcgtcgactaccccgtcgccctggtgaactcggtcaacccctac
cgtctccaggggcagaagacggctgccttcgagatcgtggacgccctcggcgatgctccc
gacatccactgcatccccgtcggcaacgccggcaacatcaccgcctactggatgggctac
accgagtacgccagggacggtatctccaccgggtccccgcgcatgctcggcttccaggcc
agcggctcggcccccatcgtcgacggcgccccggtgaccagccccagcaccatcgccacc
gccatccggatcggcaacccggcctcctggaagctcgccgagcaggccagggacgagtcc
ggcggggccatcgacaaggtcaccgaccgccagatcatggccgcctacaagctcctggcc
gcggaggagggcgtcttcgttgaactcgcctccgccgcgagcgtcgccggtctcctccag
gcctccgcggccggacaggtgcccaagggcagccgtatcgtctgcacggtcaccggtaac
ggcctcaaggacccggactgggcgctggcgggagcctcctccgccaccaccgttcccgtc
gacgcccaggccgccgccaaggccctggacctcgcctga

DBGET integrated database retrieval system