KEGG   Nocardiopsis alba: B005_3247Help
Entry
B005_3247         CDS       T02218                                 

Definition
isochorismatase family protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
nal  Nocardiopsis alba
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:nal00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3380553..3381125)
Genome map
AA seq 190 aa AA seqDB search
MTRALIVVDLQNDFCEGGSLGVNGGARTAAAVTEYARTGGYDHVVATRDHHIDPGDHFSE
NPDFVDSWPRHCEAGTPGAEFHPEFDSSVAEEVFSKGMYSAAYSGFEGTASDGETTLAAW
LRDHGVDEVDVVGIATDHCVRATAMDAAEEGFRTRVLLELTAGVSGAGVETALERLRDAG
VALEGRPPVG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaccagagcactcatcgtggtggatctacagaacgacttctgtgaggggggaagcctc
ggggtgaacggtggggcccgcaccgcggccgccgtcaccgagtacgcccgcaccggtggc
tacgaccacgtggtggccacccgcgaccaccacatcgaccccggggaccacttctccgag
aaccccgacttcgtggacagctggccgcgtcactgtgaggcgggcacccccggggcggag
ttccaccccgaattcgactcctcggtggccgaggaggtcttcagcaaggggatgtactcg
gccgcctacagcggtttcgagggcaccgcttcggacggcgagacgacgttggcggcgtgg
ttgcgcgaccacggcgtggacgaggtggacgtggtggggatcgccacggaccactgtgta
cgtgccaccgcgatggacgccgccgaggagggcttccgcacccgggtgttgctggagctg
accgcgggggtgtccggcgccggcgtggagaccgcgctggagcgactgcgcgacgcgggc
gtggccctggagggccggccgccggtcggctga

DBGET integrated database retrieval system