KEGG   Nocardiopsis alba: B005_3247Help
Entry
B005_3247         CDS       T02218                                 

Definition
isochorismatase family protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
nal  Nocardiopsis alba
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    B005_3247
Enzymes [BR:nal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     B005_3247
    3.5.1.-  
     B005_3247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3380553..3381125)
Genome map
AA seq 190 aa AA seqDB search
MTRALIVVDLQNDFCEGGSLGVNGGARTAAAVTEYARTGGYDHVVATRDHHIDPGDHFSE
NPDFVDSWPRHCEAGTPGAEFHPEFDSSVAEEVFSKGMYSAAYSGFEGTASDGETTLAAW
LRDHGVDEVDVVGIATDHCVRATAMDAAEEGFRTRVLLELTAGVSGAGVETALERLRDAG
VALEGRPPVG
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaccagagcactcatcgtggtggatctacagaacgacttctgtgaggggggaagcctc
ggggtgaacggtggggcccgcaccgcggccgccgtcaccgagtacgcccgcaccggtggc
tacgaccacgtggtggccacccgcgaccaccacatcgaccccggggaccacttctccgag
aaccccgacttcgtggacagctggccgcgtcactgtgaggcgggcacccccggggcggag
ttccaccccgaattcgactcctcggtggccgaggaggtcttcagcaaggggatgtactcg
gccgcctacagcggtttcgagggcaccgcttcggacggcgagacgacgttggcggcgtgg
ttgcgcgaccacggcgtggacgaggtggacgtggtggggatcgccacggaccactgtgta
cgtgccaccgcgatggacgccgccgaggagggcttccgcacccgggtgttgctggagctg
accgcgggggtgtccggcgccggcgtggagaccgcgctggagcgactgcgcgacgcgggc
gtggccctggagggccggccgccggtcggctga

DBGET integrated database retrieval system