KEGG   Nocardiopsis alba: B005_3493Help
Entry
B005_3493         CDS       T02218                                 

Definition
glycosyl hydrolase family 20, catalytic domain protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
nal  Nocardiopsis alba
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nal00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:nal00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3658233..3659873)
Genome map
AA seq 546 aa AA seqDB search
MSDNPRTSPMSLVPLPREIRTEGEEGLVLTATTRLSADNEAKGTLSWLRRELGAATGLPL
NVGEEEDARIRLSVDPTAGLGREGYRLIVDGEGAIIVGNDPAGVFYGAQTLRQLLPVDAY
RDAPLGEETVWRLPAVHITDAPRFRWRGAMLDIARHFQPKREILRFIDLLALHKLNVLHL
HLTDDQGWRIEIRRYPRLTEVGSWRTESQVGTSKPPVFDGRPHGGFLTQDDIREIVAYAD
ARHVTVVPEIDVPGHSQAAIHAYPELGEVGEIPVGTQWGIFEEVLAVTDNVLEFYKNVFD
ELIELFPSTYVHVGGDECPKTQWKNSESAQKRIREEGLADEDELQSWFIRQLDDHLTARG
RRLLGWDEILEGGLAPGATVMSWRGEEGGIDAARAGHDVIMAPTATSYLDYKQSESPDEP
VPVGTLLRVEDVYDSGIVPSGLTEEETEHVLGAQMNLWSEHVDNARRLDYMVFPRLTAFS
EKVWSSHERDYAAFEPRLREHLRRLDAAGVEYRPLDGPRPWHTRPGVYGWGYSPDGEAPE
QGHDRA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaacccccgcacctcacccatgtccctggtccctctcccccgcgagatcagg
acggaaggagaggaggggctggtgctcaccgccaccacccgtctctcggccgacaacgag
gccaagggcaccctctcctggctccggcgcgagctcggcgccgcgaccggtctacccctg
aacgtcggcgaggaggaggacgcccggatccggttgagcgtcgatccgaccgcgggcctc
ggccgtgagggctaccgtctgatcgtcgacggggagggcgccatcatcgtcggcaacgac
cccgccggtgtcttctacggagcccagaccctgcgccaactcctccccgtcgacgcctac
cgtgacgcgcccttgggcgaggagaccgtctggcgactccccgcggtgcacatcaccgac
gccccccgattccgatggcgcggggccatgctggacatcgcccggcacttccagcccaag
cgcgagatcctgcgcttcatcgacctgctggccctgcacaagctcaacgtgctgcacctg
cacctgaccgacgaccagggatggcggatcgagatccgtcgctacccccgcctgaccgag
gtgggctcctggcggaccgagagccaggtcggcacctccaagccccccgtgttcgacggt
cgaccgcacggcggtttcctcacccaggacgacatccgcgagatcgtggcctacgccgac
gcccgccacgtcacggtcgtcccggagatcgacgtgcccgggcactcccaggccgccatc
cacgcctaccccgagctgggcgaggtcggagagatcccggtcggcacacagtggggcatc
ttcgaggaggtgctggcggtcaccgacaacgtgctggagttctacaagaacgtcttcgac
gagctcatcgagctgttccccagcacctacgtgcacgtgggcggggacgagtgccccaag
acccagtggaagaacagcgagtcggcgcagaagaggatccgggaggagggcctcgccgac
gaggacgagctccagagctggttcatccgacagttggacgaccacctgaccgcccggggc
cggcgtctgctcggctgggacgagatcctcgagggcggtctggccccgggcgccacggtg
atgtcctggcggggcgaggagggcgggatcgacgccgcgcgtgccggccacgacgtgatc
atggcccccaccgccacgtcctacctggactacaagcagtccgagagccccgacgagccc
gtccccgtgggcaccctccttcgggtggaggacgtgtacgactccgggatcgtcccgtcc
ggtctcaccgaggaggagaccgagcacgtgctgggcgcccagatgaacctgtggagcgag
cacgtcgacaacgcgcgccggctcgactacatggtcttcccgcggctgaccgccttctcg
gagaaggtgtggtcctcccacgaacgcgactacgccgccttcgaaccgcgccttcgggaa
cacctgcgccgcctggacgcggcgggggtggagtaccgccccctggacggtcctcgtccc
tggcacacccgtcccggtgtgtacggctggggctactcccccgacggtgaggcgcccgag
cagggccacgaccgggcctga

DBGET integrated database retrieval system